KEGG   Acinetobacter schindleri: AsACE_CH00821Help
Entry
AsACE_CH00821     CDS       T04787                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
asj  Acinetobacter schindleri
Pathway
asj00020  Citrate cycle (TCA cycle)
asj00310  Lysine degradation
asj00380  Tryptophan metabolism
asj01100  Metabolic pathways
asj01110  Biosynthesis of secondary metabolites
asj01120  Microbial metabolism in diverse environments
asj01130  Biosynthesis of antibiotics
asj01200  Carbon metabolism
Module
asj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AsACE_CH00821 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    AsACE_CH00821 (sucB)
   00380 Tryptophan metabolism
    AsACE_CH00821 (sucB)
Enzymes [BR:asj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AsACE_CH00821 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: APX62255
UniProt: A0A1P8PIB8
Position
880175..881389
Genome map
AA seq 404 aa AA seqDB search
MATEIKAPVFPESVADGTIATWHKQPGEAVSRDEVICDIETDKVVLEVVAPADGTIASII
KNEGDTVLSAEVIAQFEEGAVSGATQTQAVQSEEKVEQAAAQTEAGNSPIVERTQVADQA
PAVRKALTESGIAASDVSGTGRGGRITKEDVANHQAKPAAPAAAPLSVAVGERIEKRVPM
TRLRKRVAERLLAATQETAMLTTFNEVNMKPIMEMRNQYKDAFEKRHGARLGFMSFFVKA
ATEALKRYPAVNASIDGDDIVYHGYYDIGVAVSSDRGLVVPVLRDTDRMNYAEVENGIRA
YAGKAREGKLAIEDMTGGTFTITNGGTFGSLLSTPILNTPQTAILGMHKIQERPMAVNGQ
VEILPMMYLALSYDHRLIDGKEAVGFLVTIKELLEEPARLILDL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaattaaagcaccggtatttccagagtcagttgcggacggtacgatcgca
acttggcacaaacaaccaggtgaagcagtatcacgtgatgaagtgatctgtgatattgag
actgataaagttgttttagaagttgttgctcctgctgacggtacaattgcatcaatcatc
aaaaatgaaggcgacacagtgctttctgctgaagtgattgctcaatttgaagaaggtgct
gtttctggcgctacacaaactcaagcagttcaatctgaagagaaagttgagcaagctgct
gcacaaactgaagcgggtaattcgccgatcgttgagcgtactcaagttgctgaccaggca
cctgcagtacgtaaagctttaactgaatctggtattgctgcatctgacgtatctggtaca
ggtcgtggcggtcgcatcaccaaagaagatgttgcaaaccatcaagcgaaaccagcagca
cctgctgctgcaccgctgagcgttgcagttggtgagcgtattgaaaaacgtgtacctatg
actcgtctgcgtaaacgtgttgctgaacgtctgcttgctgcaactcaagaaacagcaatg
ctgacgacgttcaacgaagtcaacatgaaaccaatcatggaaatgcgtaaccagtacaaa
gatgcgtttgaaaaacgtcatggtgcgcgtctaggtttcatgtcattcttcgttaaagcg
gcaactgaagcgcttaaacgctacccagcggtgaatgcatctatcgatggcgacgacatc
gtttatcacggttactatgacatcggtgtagcggtttcttctgatcgtggtctggtggtt
cctgtacttcgtgatacagaccgcatgaactacgctgaagttgaaaatggtatccgtgca
tacgctggtaaggcacgtgaaggtaaacttgcgattgaagacatgactggtggtactttc
acaattaccaacggtggtactttcggttcattgctttcaactccaatcttgaacactcca
caaactgcgattctgggtatgcataaaatccaggaacgtcctatggcagtgaatggtcag
gttgaaatcttgccaatgatgtacctagcgctttcttatgaccaccgtctaatcgatggt
aaagaagctgtaggtttccttgtaacaatcaaagaattgttagaagaaccagctcgtctg
atccttgatctttaa

DBGET integrated database retrieval system