KEGG   Acinetobacter schindleri: AsACE_CH01444Help
Entry
AsACE_CH01444     CDS       T04787                                 

Gene name
pcaF-1
Definition
(GenBank) beta-ketoadipyl-CoA thiolase 1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
asj  Acinetobacter schindleri
Pathway
asj00071  Fatty acid degradation
asj00072  Synthesis and degradation of ketone bodies
asj00280  Valine, leucine and isoleucine degradation
asj00310  Lysine degradation
asj00362  Benzoate degradation
asj00380  Tryptophan metabolism
asj00620  Pyruvate metabolism
asj00630  Glyoxylate and dicarboxylate metabolism
asj00640  Propanoate metabolism
asj00650  Butanoate metabolism
asj00900  Terpenoid backbone biosynthesis
asj01100  Metabolic pathways
asj01110  Biosynthesis of secondary metabolites
asj01120  Microbial metabolism in diverse environments
asj01130  Biosynthesis of antibiotics
asj01200  Carbon metabolism
asj01212  Fatty acid metabolism
asj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:asj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AsACE_CH01444 (pcaF-1)
   00630 Glyoxylate and dicarboxylate metabolism
    AsACE_CH01444 (pcaF-1)
   00640 Propanoate metabolism
    AsACE_CH01444 (pcaF-1)
   00650 Butanoate metabolism
    AsACE_CH01444 (pcaF-1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AsACE_CH01444 (pcaF-1)
   00072 Synthesis and degradation of ketone bodies
    AsACE_CH01444 (pcaF-1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AsACE_CH01444 (pcaF-1)
   00310 Lysine degradation
    AsACE_CH01444 (pcaF-1)
   00380 Tryptophan metabolism
    AsACE_CH01444 (pcaF-1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AsACE_CH01444 (pcaF-1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AsACE_CH01444 (pcaF-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AsACE_CH01444 (pcaF-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asj04147]
    AsACE_CH01444 (pcaF-1)
Enzymes [BR:asj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AsACE_CH01444 (pcaF-1)
Exosome [BR:asj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AsACE_CH01444 (pcaF-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: APX62846
UniProt: A0A1P8PK15
Position
complement(1518414..1519625)
Genome map
AA seq 403 aa AA seqDB search
MLNAYIYDGLRSPIGRHAGSLASVRPDDLAATVIKNLLEKTGIPAADVEDVIFGSTNQAG
EDSRNVARFAALLAGMPVTVPGQTVNRLCASGLGAVIDSARAITAGEGELYIAGGVESMT
RAPFVMGKAESAYSREAKIYDTTIGTRFPNRKFTDQFGAHSMPETGDNVAEEFGISREQA
DTFAAVSQAKYQAAKEAGFFEGEITPIEVSQGRKLPPKQVTEDEHPRASSTFEALSKLKP
LFEGGVVTAGNASGINDGAAALIIGSEKVQEQYGLKPLARILSSAAAGIEPRIMGAGPIE
AIKKAVQRAGLTLDDMDVIEINEAFASQVLSCLKGLDVAFDDPRVNPNGGAIAIGHPLGC
SGARLALTVARQLQRTGKKYAVISLCIGLGQGLAMVIENPEAA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatgcatatatctatgacggtttacgttcaccaatcggtcgccatgcaggaagt
ctggcaagcgtacgcccagatgatctggcagctacagtcattaaaaacctgctggaaaaa
accggtattccggcagcagatgtagaagatgtaatctttggtagcaccaaccaggccggt
gaagacagccgtaatgtggcacgttttgcagcattgttagcaggtatgccggtaacagtt
ccgggtcagacggtaaaccgcttatgtgcatcaggcctcggtgctgtgattgattcggca
cgtgccattactgcaggcgaaggtgagttgtacattgccggtggcgtagaaagcatgacc
cgcgcaccttttgtaatgggtaaagcagaaagcgcgtattcacgtgaggctaaaatttat
gacaccacgattggtacacgtttcccgaaccgtaaattcacggatcagtttggcgcgcac
agcatgcctgaaacaggtgataacgtggctgaagaattcggtattagccgtgaacaggct
gacacctttgctgctgtatcacaagccaaatatcaggctgcaaaagaagcgggattcttt
gaaggtgaaattactccaattgaagtttcacaagggcgtaaattaccgcctaaacaggtg
actgaagatgaacatccacgtgcatcttcaacatttgaagcattatccaagctaaaaccg
cttttcgaaggtggtgtagtgactgcgggtaatgcatcaggtatcaatgacggcgctgca
gcactgattatcggcagtgaaaaagttcaggaacagtatggcttaaaacctctggctcgt
atcctgtcttctgcagctgctggcattgagccacgcatcatgggcgcgggcccaattgaa
gcgattaaaaaggcagtacaacgtgcaggcttaacgctggacgatatggacgtaattgag
attaatgaagcctttgccagccaggtattatcttgcctgaaaggtctggatgtggctttt
gatgatccgcgtgtcaatccaaatggtggtgccattgcgattggtcatccactcggctgt
tcaggcgcgcgtttggcgttgacggttgcacgtcaattacagcgtacaggcaagaaatat
gccgtgatcagcctgtgtattggtttaggtcaaggtctggcgatggtgattgagaatcct
gaagcagcttaa

DBGET integrated database retrieval system