KEGG   Acinetobacter schindleri: AsACE_CH02227Help
Entry
AsACE_CH02227     CDS       T04787                                 

Gene name
acnA
Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
asj  Acinetobacter schindleri
Pathway
asj00640  Propanoate metabolism
asj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AsACE_CH02227 (acnA)
Enzymes [BR:asj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     AsACE_CH02227 (acnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: APX63600
UniProt: A0A1P8PM52
Position
complement(2323741..2326341)
Genome map
AA seq 866 aa AA seqDB search
MNNYRKPLQGTQLEYYDVRQAVEDIQPGAYAKLPYTSKVLAEQLVRRCDPAILEQSLRQL
IERKQEHDFPWYPARVVCHDILGQTALVDLAGLRDAIADQGGDPSKVNPVVPTQLIVDHS
LAVEYGGFDPDAFEKNRAIEDRRNEDRFHFIEWTKTAFENVDVIPAGNGIMHQINLEKMS
PVIQNRDGVAFPDTCVGTDSHTPHTDALGVISIGVGGLEAENVMLGRASWMRLPDIIGVE
LVGQRQPGITATDIVLALTEFLRKERVVGAYLEFFGEGADSMSVGDRATISNMTPEYGAT
AAMFYIDQNTIDYLTLTGRESEQVKLVESYAKEIGLWSSEMTQAEYPRVLRFDLSTVTRN
IAGPSNPHARVSTADLKEKGIAGVVENRTDGLMPDGAIIIAAITSCTNTSNPRNTVAAGL
LARKANELGLVRKPWVKSSFAPGSKAAALYLEEAGVLEDLEKLGFGIVAYACTTCNGMSG
ALDPKIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
KDSLGNDKDGNPIYLKDIWPSDEEIDALVKESVKPEQFNKVYIPMFDLGEREKAASPLYD
WRPQSTYIRRPPYWEGALAAPRTLTNMRPLAILGDNITTDHLSPSNAIVRDSAAGEYLAK
MGVPEEDFNSYATHRGDHLTAQRATLANPKLYNEMVVRSDGTIKQGSKARVEPEGEVMRM
WEAIETYMNRKQPLIVIAGKDYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLVGMG
VLPLEFKPGTDRKTLKLDGTELYSVIGNIAPRSTLTLVIERATEDGKEQTIEVPVTCRLD
TEEEVSVYEAGGVLQRFAQDFLEGNV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactaccgtaaaccgctgcaaggtacccagctggaatattacgacgtgcgtcag
gccgttgaagatattcagccaggcgcatatgccaaacttccctatacttccaaagtgctg
gcagagcagttggtacgccgttgtgatcctgccattctggaacagtcactgcgtcagcta
attgagcgtaaacaggagcatgatttcccgtggtatccggcgcgtgtagtgtgtcatgac
attttggggcaaacggcactggtcgatcttgccggtctgcgtgatgcgattgccgatcag
ggcggtgacccctccaaagtcaatccggtggtgccaacccagctgattgtcgaccactcg
ctggcagtggaatatggtggctttgatccggatgcatttgagaaaaaccgtgcgattgaa
gaccgccgtaacgaagaccgtttccattttattgaatggaccaaaacggcttttgaaaat
gttgatgtgattccagccggtaacggtatcatgcaccagattaatctggaaaaaatgtca
ccggtgattcagaaccgtgacggtgttgcattcccggacacttgtgtaggaactgactcg
cataccccacataccgatgccttgggcgtaatctcgattggtgtcggtggtctggaagct
gagaacgtgatgctgggccgtgcatcctggatgcgtctgccggatattattggggtagaa
ctggtgggccaacgtcagccgggtatcaccgcaacggatatcgttttggccttaactgaa
ttcctgcgtaaggaacgtgtggttggcgcttatctggaattctttggtgaaggtgcggac
agcatgtcagtgggtgatcgcgccacaatttctaatatgacccctgaatatggcgcaacc
gcagccatgttctatattgaccagaacaccattgattatctgacgttaaccggtcgtgag
tctgagcaagtcaaactggttgaaagctatgccaaggaaattggcctgtggtcatcggaa
atgacacaagcagaatatccacgtgtacttcgtttcgacttatctacagtgacgcgtaat
attgcaggtccatcgaatccgcatgcgcgtgtttcaactgctgacctgaaagagaaaggc
attgccggagtagtagaaaaccgtaccgatggcctgatgccagatggtgcgatcatcatc
gcggcgatcacttcatgtaccaatacttccaacccacgtaatactgttgcagcaggttta
ttggcacgtaaagccaatgagcttggtttagtgcgtaagccatgggtgaaatcatctttt
gcaccgggttctaaagcagctgcgctgtatttggaagaagcgggtgtacttgaagatctt
gaaaaactgggctttggtatcgtagcgtatgcatgtacgacctgtaacggcatgtcaggt
gcgcttgatccaaagattcagcaggaaattattgaccgtgacctgtatgccacagcggta
ttgtccggtaacagaaacttcgatggccgtatccatccgtatgcaaaacaggctttcctg
gcatctccaccattagtcgtggcttatgcaattgccggtacaattcgttttgatatcgaa
aaagattcactgggcaacgataaagacggcaatccgatttacctgaaagacatctggcca
tcggatgaagaaattgatgctttggtaaaagagtcagtcaagccggagcaatttaataaa
gtttatattccgatgtttgatctgggcgaacgtgagaaggcagcgagtccgctgtatgac
tggcgcccgcaaagtacctatattcgccgtccaccatattgggaaggtgcactggctgca
ccgcgtacactcaccaacatgcgtccactggctattcttggcgataacattaccactgac
catttatcgccttcaaatgcaattgtgcgtgattcggcagcgggtgaatacttagcaaaa
atgggtgtgcccgaggaagactttaactcttatgcgacgcaccgtggcgatcacctgact
gcacagcgtgcaaccctagcgaatcctaagttgtataacgaaatggtggtccgttctgat
ggcaccattaagcagggttctaaagcgcgtgtggaaccagaaggcgaagtgatgcggatg
tgggaagcaattgaaacctacatgaaccgtaaacaacctttgatcgtgattgctggtaaa
gactatggtcagggttcaagtcgtgactgggcagccaaaggtgtgcgtctggcaggtgta
gaagcgattgtggctgaaggttttgagcgtattcaccgtaccaatttagtcggtatgggt
gttcttccacttgagtttaaaccaggtacagaccgcaagactttaaagctggatggtact
gagttgtatagtgtgattggtaatattgcaccacgttcgactttgacacttgttattgag
cgcgcaactgaagatggtaaggaacagacgattgaagtgcctgtgacctgtcgtctggat
accgaagaagaagtgtctgtttatgaagcgggtggggttttacagcgttttgcacaggat
ttcttggaagggaatgtttaa

DBGET integrated database retrieval system