KEGG   Acinetobacter schindleri: AsACE_p100043Help
Entry
AsACE_p100043     CDS       T04787                                 

Gene name
bdhA
Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
asj  Acinetobacter schindleri
Pathway
asj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:asj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AsACE_p100043 (bdhA)
Enzymes [BR:asj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AsACE_p100043 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AsACE_p100043 (bdhA)
    1.1.1.-  
     AsACE_p100043 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: APX64255
UniProt: A0A1P8PP02
Position
p1AsACE:50410..51468
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPKVLPGTVGIQVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIQIGQHVVVEPYIIADDVPTGPNDKYHLSKNMNF
IGLGGRGGGLSEKIAVQRRWVHPISNDIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLTVIITELSAKRKEKAIEAGVADYVLDPSKVDVVAEVMKITED
RGVDVAFECSSVNKVMDTLVAAMKPTGVVVIVSIWSHPATINVHSVVMKELDIRGTIAYV
NDHQETIRLVEQGKINLEPFITQRIALDDLVSKGFETLIHNNESAVKIIVHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggctcgtttttatgaccgaggggatattcgaattgaagatatccctgaaccg
aaagtacttccaggcacagttggaattcaagttgcgtggtgtggtatttgcggtacagat
ttacatgaattcatggaaggtcctatttttattccaccttgtggtcacccacacccaatt
tcgggagaatctgcacctgtaacaatgggacatgaattttcaggcgtagtttatgcagtt
ggtgagggagtagatgatattcaaattgggcaacatgtcgtagttgaaccctacattatt
gcggatgatgtaccgactgggccgaatgataaatatcatttatcaaaaaatatgaacttt
attggtttaggcggacgcggcggcggtctttctgaaaaaattgcggttcagcgccgttgg
gtacatcctatttcaaatgatattcccttagaccaagcagcattgatagaacctttgtcc
gttggtcatcatgcctatgtacgaagtggtgcaaaagctggcgatatcgcactggttggt
ggagcaggccctataggcttacttttatcagccattttaaaggctaaaggtctcacggtc
atcattactgaactgagtgcaaaacgtaaagaaaaagcgatagaagcgggtgttgccgat
tatgtactagacccatctaaggttgatgtagttgctgaggtaatgaaaattacagaagac
cgcggtgtagatgtcgcttttgaatgtagtagtgtcaataaagtcatggatacactcgtt
gcagcaatgaaaccaactggtgtagtcgttatcgtttctatttggagccatcctgccaca
attaatgtgcatagtgtagtgatgaaagaactagatattcgtggcacgatagcttatgtc
aatgaccatcaggaaaccatccgtttagtcgagcaaggtaagattaatctagaacctttt
attacccaacgtattgcattagatgatcttgtttctaaaggctttgaaacgttgattcat
aataatgagtctgctgtaaaaattattgttcatccatag

DBGET integrated database retrieval system