KEGG   Arcobacter skirrowii: EI285_03465Help
Entry
EI285_03465       CDS       T05743                                 

Definition
(GenBank) nucleoid-structuring protein H-NS
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
ask  Arcobacter skirrowii
Pathway
ask00360  Phenylalanine metabolism
ask00362  Benzoate degradation
ask00621  Dioxin degradation
ask00622  Xylene degradation
ask01100  Metabolic pathways
ask01120  Microbial metabolism in diverse environments
ask01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ask00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    EI285_03465
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EI285_03465
   00622 Xylene degradation
    EI285_03465
   00621 Dioxin degradation
    EI285_03465
Enzymes [BR:ask01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     EI285_03465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: AZL53684
Position
complement(648440..649411)
Genome map
AA seq 323 aa AA seqDB search
MLEKKGTILSVREDLKVFDCTIRDGGLVNNFYFSDEFVKAHYEMCVKAGVDYMEIGKNVS
PTLMSEKEYGAWNFCKEEDIRRVVGENKTNLKIAVMSDIGRSLKEELRPKEQSVVDMIRV
ATYIHQIPAAIELIEDAHAKGYETTVNIMAISKVSEKELDEVLEALSKTNVDVIYIADSF
GSFYPEQIRDLTEKYLSFAEKSGKKVGIHAHNNLQLAYANTLEAMIYGASFLDVTVSGLG
RGAGNCPLELLLGFLKNPKYKQMPVLEFIENYIVDLEKKLDWGYSIPYMITGQLNEHPRA
AMKARDEGDTKYREFFKNISFME
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaaaaaagggaactatcctttcagttagagaagatttaaaagtttttgattgc
acaattagagatggtggacttgtaaataatttttactttagtgatgaatttgtaaaagct
cactatgagatgtgtgtaaaagctggtgttgattatatggagattggtaaaaatgtatct
ccaactttaatgagtgaaaaagagtatggagcttggaatttctgtaaagaagaagatatt
agaagagttgttggggagaacaaaacgaatctaaaaattgctgtaatgagtgatattgga
agaagtttaaaagaagagcttagaccaaaagagcagagtgttgttgatatgattagggtt
gcaacatatattcatcaaattccagcagcaattgaactaatagaagatgctcatgcaaaa
ggttatgaaacaactgtaaatattatggctatttcaaaagtatcagaaaaagagttggat
gaagttttagaggctttaagtaaaacaaatgttgatgtaatttatatagctgatagtttt
ggatcattttatccagaacaaataagagatttaacagaaaaatatctaagttttgcagaa
aaatcaggtaaaaaagttggaattcatgcacataacaatcttcaacttgcatatgcaaat
actttagaagctatgatctatggagcaagttttcttgatgttacagtttcaggtctagga
cgtggtgctggaaactgtccacttgaacttctattaggatttttgaaaaatccaaaatat
aaacagatgcctgttttagagtttattgaaaactatatagttgatttagagaaaaaactt
gactggggatatagtattccttatatgataactggtcaactaaatgaacacccaagagca
gctatgaaagctagagatgaaggcgatacaaaatatagagagtttttcaaaaatatatct
tttatggagtaa

DBGET integrated database retrieval system