KEGG   Aequorivita sublithincola: Aeqsu_0057Help
Entry
Aeqsu_0057        CDS       T02132                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
asl  Aequorivita sublithincola
Pathway
asl00020  Citrate cycle (TCA cycle)
asl00640  Propanoate metabolism
asl01100  Metabolic pathways
asl01110  Biosynthesis of secondary metabolites
asl01120  Microbial metabolism in diverse environments
asl01130  Biosynthesis of antibiotics
asl01200  Carbon metabolism
Module
asl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aeqsu_0057
   00640 Propanoate metabolism
    Aeqsu_0057
   00660 C5-Branched dibasic acid metabolism
    Aeqsu_0057
Enzymes [BR:asl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Aeqsu_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AFL79589
UniProt: I3YRH1
Position
65989..67179
Genome map
AA seq 396 aa AA seqDB search
MNLHEYQGKEILNSFGVEIQRGIVATTPKEAVEAAKKLTETTGTGWHVIKAQVHAGGRGK
GGGVKLAKNLQEVETIAGNIIGMDLVTPQTSAEGKRVHQVLVTEDVYYPGDSEPEEYYMS
VLLNRSTGRNMIMYSTEGGMDIETVAEETPHLIFTEEVDPAVGLLGFQARRVAFNLGLSG
KAFKEMTKFVTALYKAYNESDSSLFEINPVLKTSDDRIIAVDAKVSIDDNALFRHKDYME
MRDKREENPVEVEAQEKGLNYVDLDGNVGCMVNGAGLAMATMDLIKQAGGEPANFLDVGG
TANAERVEAAFKLILKDPNVKAILVNIFGGIVRCDRVAQGIIDAYKNMGTINVPIIVRLQ
GTNADVAKKMIDDSGLDVQSAIEFQEAADKVKAVLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaataccaaggaaaagaaatcttaaacagttttggcgttgaaatacaa
cgcggcatcgtggcaactactccaaaagaggcagtagaagccgcaaaaaaacttacagaa
acaaccggaacgggctggcacgtaattaaggctcaagttcacgcaggtggtcgtggtaaa
ggtggtggtgtaaaacttgcgaagaacttacaagaagttgaaacgattgcaggaaacatc
attgggatggatcttgtaactccacaaacttctgctgaagggaaacgagttcatcaagtt
ttggttactgaagatgtttattaccctggtgatagcgagccagaagaatattatatgagt
gttcttttaaaccgctctacaggaagaaacatgattatgtattctaccgaaggtggaatg
gatattgaaaccgttgctgaagaaactccgcatttaatttttactgaagaagttgatcca
gctgttggccttttgggctttcaagctagaagagtcgctttcaaccttggattgagcggc
aaagcctttaaggaaatgacaaaatttgttactgcactttacaaagcatataatgaatct
gattcttctcttttcgaaataaatcctgttttaaaaacaagtgacgatagaattattgcg
gttgatgctaaagtgagtattgacgacaatgcacttttccgtcataaagattatatggaa
atgcgcgacaaacgcgaggaaaatcctgtagaagttgaagcacaagaaaaaggactaaac
tatgtggatcttgacggaaacgttggttgtatggttaatggcgccggacttgcaatggca
acaatggatcttattaagcaagctggtggtgagcctgcaaactttcttgacgtaggtgga
actgcaaatgctgagcgagttgaagctgctttcaaattaattttgaaagacccgaacgta
aaagcaattttggtaaatatttttggtggaatcgtacgttgcgaccgtgtggcacaagga
attattgacgcttataaaaatatgggaactatcaatgtgcctatcattgtgcgtttacaa
ggaacaaatgcagatgttgcaaagaaaatgattgatgacagcggattggatgttcaaagt
gcgattgaatttcaagaagctgcagataaagtgaaagctgtattggcctaa

DBGET integrated database retrieval system