KEGG   Aequorivita sublithincola: Aeqsu_0507Help
Entry
Aeqsu_0507        CDS       T02132                                 

Definition
(GenBank) uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
asl  Aequorivita sublithincola
Brite
KEGG Orthology (KO) [BR:asl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Aeqsu_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Collagen_bind
Motif
Other DBs
NCBI-ProteinID: AFL80019
UniProt: I3YSQ1
Position
498446..498832
Genome map
AA seq 128 aa AA seqDB search
MVQQVTQGIKISVKTEFDGTFYKNRKMQYAFAYNITIENQSKDTVQLTSRSWKIKDSLNN
TEIVEGEGVIGQKPILLPGEKHSYTSGCLLFSPFGAMKGHYNMVNFATTRKFRVSIPLFN
LSAPFSMN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacaagtaacacaaggaattaaaatttcggtaaaaaccgaatttgatggcacg
ttttacaaaaatcgtaaaatgcagtatgcctttgcctacaacattactattgaaaaccaa
agcaaagacacggtgcagctaacttctcgtagctggaaaataaaagattctctcaacaat
actgaaattgtagaaggcgaaggcgtaataggccaaaaaccgatactgctaccaggagaa
aaacatagttacaccagtggctgtcttttattctctccttttggagcaatgaaaggtcat
tataatatggtaaactttgcgactacccgaaagtttagggtttcaattccgctttttaat
ttgagtgcgcctttttcaatgaattaa

DBGET integrated database retrieval system