KEGG   Aequorivita sublithincola: Aeqsu_1312Help
Entry
Aeqsu_1312        CDS       T02132                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
asl  Aequorivita sublithincola
Pathway
asl00860  Porphyrin and chlorophyll metabolism
asl01100  Metabolic pathways
asl01110  Biosynthesis of secondary metabolites
asl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Aeqsu_1312
Enzymes [BR:asl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Aeqsu_1312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DRMBL
Motif
Other DBs
NCBI-ProteinID: AFL80805
UniProt: I3YUY7
Position
1399644..1400312
Genome map
AA seq 222 aa AA seqDB search
MPTVLATKILKENQRSLLLHADVSLVEYNAINIEFLPFENLSNIAKAIFTSQNGVKSFLA
NVRSSAVENCFCVGERTKSLLEENGLKVIKMTEYATELADYLIKNHNKDSFHFFCGNIRS
DEIPSKLKENNIAFKEITVYKTTLNLKKFERNFDAILFFSPSGVRSYFEANNKSERPETL
SVCIGTTTASEAKNYTENVVIANATTVESVIAKAVKTLKNYD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccgacggttctagcaactaaaatattaaaggaaaatcagagatctttactgcttcat
gcggatgtttcgttggtggaatacaatgctataaatattgaattccttccttttgaaaat
ctttcaaatattgcaaaagctattttcacgagtcaaaatggagttaaatcatttttagca
aatgtccgttcgagcgcagtcgagaactgcttttgcgttggcgaaaggacaaaatcatta
ttggaagaaaatggtttaaaagtgattaaaatgaccgaatatgcaacggaattggcagat
tatttaatcaaaaatcacaacaaggactcctttcattttttctgcggaaacattcgaagt
gatgaaattccttcgaaactaaaggaaaataatattgcgtttaaagagattacagtttat
aaaacaactttaaacctaaagaagtttgaaagaaatttcgatgccattttgtttttcagt
ccaagtggcgtacgaagttattttgaagctaataataaatctgaaaggcctgagacttta
tcagtttgtataggaaccacaaccgcttctgaagcaaaaaattatacagaaaatgtggta
attgcaaatgccacaaccgtggaaagcgtaattgctaaagcggtaaaaacattaaaaaat
tatgattaa

DBGET integrated database retrieval system