KEGG   Aequorivita sublithincola: Aeqsu_2190Help
Entry
Aeqsu_2190        CDS       T02132                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
asl  Aequorivita sublithincola
Pathway
asl00220  Arginine biosynthesis
asl00250  Alanine, aspartate and glutamate metabolism
asl00471  D-Glutamine and D-glutamate metabolism
asl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Aeqsu_2190
   00220 Arginine biosynthesis
    Aeqsu_2190
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Aeqsu_2190
Enzymes [BR:asl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Aeqsu_2190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Phage_T4_gp36
Motif
Other DBs
NCBI-ProteinID: AFL81650
UniProt: I3YXD2
Position
complement(2356833..2357747)
Genome map
AA seq 304 aa AA seqDB search
MLDYQAILEEIHSSLKKVDNTGEVANYIPELGNVSKDKFGIHLQLITGESHSVGDASEKF
SIQSISKVLSLAKAFQLVGNDLWERVDVEPSGNPFNHLSLLELENGIPRNPLINSGAIVI
ADVLLSHLKNPKEDFLNFVKELTHDDSISYNNKIAESERITGFNNYAAANLLKAYGNLNN
EVEDVLDFYFHQCSIMMDCKQLTNAFFVFANKGACLKNVQHLTASQVKRINAIMLTCGFY
DEAGEFAFEVGLPGKSGVGGGIVALLPHCFTIATWAPALNPKGNPYLGMQALEQFTTRTK
LSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgctagattatcaagccatattggaagaaattcacagctcgctcaagaaggttgacaac
acgggagaagtcgcgaattatattccagagttggggaatgtttcaaaagataaatttgga
atccatcttcagctgattactggtgaaagtcattctgttggcgatgcttcagaaaaattt
tcaattcaaagtatttcaaaagtgctttcgcttgcaaaggcgtttcagcttgttggaaat
gatctttgggaacgtgtagatgtggaaccttcgggaaacccttttaaccatctttcgctt
ttagaactggaaaacggaattcctcgaaacccgttaataaactccggagccattgtgatt
gctgacgttctgctttctcacttaaaaaatcctaaagaagactttttaaattttgtaaag
gaattgacgcacgacgatagtatttcctacaacaataaaattgccgaatctgaacgaatt
acaggtttcaacaattatgctgcggcaaatttattaaaagcctacggaaatctcaataat
gaagtagaagatgttttggatttttattttcatcaatgctccataatgatggattgcaag
caacttaccaacgcttttttcgtttttgcaaacaaaggagcttgtttaaaaaatgttcag
catttaactgccagccaagtgaagcgaattaatgcaataatgcttacttgcggtttttac
gacgaagctggcgaatttgcttttgaagtaggattgccagggaaaagtggcgttggcggc
ggtatcgtagcacttttaccacactgctttactattgctacttgggcgccagccttgaac
ccaaaaggaaatccatatttaggaatgcaggctttggaacaatttacaacaagaacgaaa
ctgtctattttttag

DBGET integrated database retrieval system