KEGG   Aequorivita sublithincola: Aeqsu_2763Help
Entry
Aeqsu_2763        CDS       T02132                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
asl  Aequorivita sublithincola
Pathway
asl00240  Pyrimidine metabolism
asl00250  Alanine, aspartate and glutamate metabolism
asl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Aeqsu_2763
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Aeqsu_2763
Enzymes [BR:asl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Aeqsu_2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF4431 Pribosyltran
Motif
Other DBs
NCBI-ProteinID: AFL82213
UniProt: I3YYZ5
Position
complement(2971475..2972410)
Genome map
AA seq 311 aa AA seqDB search
MELSVNHLLGIKYITEADIQLIFETADHFKEVINRPIKKVPSLRDITIANLFFENSTRTK
LSFELAEKRLSADVINFASSSSSVTKGETLIDTVNNILSMKVDMVVMRHPNPGAGVFLSK
HVDASIINAGDGAHEHPTQALLDTYSIREKLGDVAGKKVVIVGDILHSRVALSNIFALQK
LGATVKVCGPKTLIPKYIEKLNVQFEPNLVKALEWCDVANMLRVQNERMDISYFPTTREY
TQQFGLNKKLLDSLNKEIVVMHPGPINRGVEITSDVADSKQSIILEQVQNGVAIRMAVIY
LLASKIKHHED
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaactgagtgtaaaccacttactaggaataaaatatatcaccgaagccgatattcaa
ctcatcttcgaaacggcagatcatttcaaggaagttattaaccggcccattaaaaaagtt
ccttcgcttcgcgatattacgattgccaatcttttctttgaaaacagtaccagaacaaaa
ctttcttttgaacttgctgaaaagcgtctttcagcagacgttattaattttgcatcttca
agttcttcagtaaccaaaggcgaaacgcttattgatactgtaaacaacatattatcaatg
aaggttgatatggtggtgatgcgccacccaaatccaggagctggagtatttctttcaaaa
cacgttgacgcaagtataataaacgctggagacggtgcgcacgaacatccaacccaagca
ttgctcgacacgtattcaattcgtgaaaaacttggagatgtagctggaaaaaaagttgtt
attgttggtgatattcttcattcacgagttgctttatcaaacatttttgcacttcaaaag
ctaggagcgacggttaaggtgtgcggtcctaaaacgcttattccaaaatatatagaaaaa
ttaaatgttcaatttgaaccaaacctcgtaaaagctttagaatggtgtgatgttgcaaat
atgcttcgtgttcaaaacgaacggatggacattagttattttccaacaactagagaatat
acgcagcaattcggcctaaacaaaaagttgctggattcgctaaataaagaaattgtagta
atgcacccaggcccaataaaccgtggtgtggaaattactagtgatgtagcagacagcaaa
caatcgatcattttagaacaagtacaaaacggagttgccatccggatggcagtaatctat
ttattagcttcaaaaataaaacatcatgaagattga

DBGET integrated database retrieval system