KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0193Help
Entry
MOUSESFB_0193     CDS       T01857                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
asm01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:asm00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    MOUSESFB_0193
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:asm01011]
    MOUSESFB_0193
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asm03036]
    MOUSESFB_0193
Enzymes [BR:asm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     MOUSESFB_0193
Peptidoglycan biosynthesis and degradation proteins [BR:asm01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   MOUSESFB_0193
Chromosome and associated proteins [BR:asm03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    MOUSESFB_0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3
Motif
Other DBs
NCBI-ProteinID: BAK79335
Position
234002..234673
Genome map
AA seq 223 aa AA seqDB search
MKKGILIASFIIIILGFIFIFKYFNRGELGQVISKRIIVIDAGHGGVDTGSIGYSNTLEK
DVTLNISLKLGQKLEENGFDIYYTREEDVSLGDSEFYDLNSRIKIINNLKPDVFLSIHLN
GSEYESARGVETYTRSLDNKSYLLGECIQDELSSIEYTTDRGVKTTKDRRLAILNRTKYV
GVLLELGFITNESDEEYLISVSGQDIIVGCIVSGVLDYFNKIQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggggatcttaatagcatcatttattattataattttgggtttcatattcatc
tttaaatattttaatagaggggaattagggcaggttatatcaaagagaataatagttatc
gatgcaggacatggtggtgttgatactggatctataggatatagtaatacacttgagaag
gatgtaacgcttaatatttcattaaagcttggtcaaaagcttgaggaaaatggatttgat
atttattacactagagaggaggatgtttctttgggagatagcgagttttatgatttaaat
agtaggattaaaattataaataatttgaagccagatgtatttttatccatacatttaaat
gggagtgagtacgaaagtgctaggggagttgaaacctataccagatcattagataataaa
agttatcttcttggtgagtgtatacaggatgaactatcttctatagagtatacaacagat
agaggagttaaaacaactaaggatagaaggcttgctattttaaatagaacaaaatatgtg
ggagtattacttgaacttggatttataactaatgaaagtgatgaggaatatttaatttca
gtaagtggacaagatattatagttggttgtatagtatccggagttttggattatttcaat
aaaattcaatag

DBGET integrated database retrieval system