KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0403Help
Entry
MOUSESFB_0403     CDS       T01857                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
asm00450  Selenocompound metabolism
asm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MOUSESFB_0403 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:asm03016]
    MOUSESFB_0403 (selD)
Enzymes [BR:asm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     MOUSESFB_0403 (selD)
Transfer RNA biogenesis [BR:asm03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    MOUSESFB_0403 (selD)
 Prokaryotic Type
    MOUSESFB_0403 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: BAK79545
Position
458918..459673
Genome map
AA seq 251 aa AA seqDB search
MGGIPVLCLNIVGFPKCLPIEVLCDILKGSADKVKEAGAIVTGGHSIQDNEPKFGLSVIG
KVCPDSVYKNYGAKIGDKLVLTKRLGVGTIITAIKGEICSDDAYNDAVASMTTLNKYAYE
ASIGIKINACTDITGFSLLGHGYEMAYGSKVSLHLDKKSIPVIESSIEYLRNGFIPEGTY
SNKKYLSNNVYCKCEEWVEDILFEPQTSGGLLFSVEEDDLERFKKNLESRHVFYKVIGEV
RKLEDKFLYVE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaatacctgtactttgcctaaatattgttggttttcctaaatgtcttcctatt
gaggttttatgtgatattttaaaaggtagtgcagataaggtaaaagaggctggggctatc
gttactggaggtcattcaattcaagataatgaacctaaatttggactttctgttattggt
aaagtttgtcctgatagtgtttataaaaattatggagcgaagattggagataagcttgtt
ctaactaaaaggcttggtgttgggacgattattacggcgataaaaggagagatttgttct
gacgatgcttataatgatgctgttgcttcaatgactactttaaataaatatgcgtatgag
gcttccattggtataaaaataaatgcttgtacagatataacaggattttcacttttaggt
catggatatgagatggcatatggttctaaagtttcattacatttggataaaaaaagtatt
ccagtgattgaaagttctattgaatacttaagaaatggatttattccagaaggtacgtat
tctaataaaaaatacctatccaataatgtttattgcaaatgtgaagagtgggtcgaggat
atattatttgaaccacaaacgtctggaggattattgttttctgttgaagaagatgatttg
gaaaggtttaagaaaaatttggagagtagacacgttttttacaaagtgattggcgaggtt
agaaaacttgaagataaatttttatatgtagaataa

DBGET integrated database retrieval system