KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0934Help
Entry
MOUSESFB_0934     CDS       T01857                                 

Gene name
sgbU
Definition
(GenBank) putative L-xylulose 5-phosphate 3-epimerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
asm00040  Pentose and glucuronate interconversions
asm00053  Ascorbate and aldarate metabolism
asm01100  Metabolic pathways
asm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MOUSESFB_0934 (sgbU)
   00053 Ascorbate and aldarate metabolism
    MOUSESFB_0934 (sgbU)
Enzymes [BR:asm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     MOUSESFB_0934 (sgbU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 DUF1744
Motif
Other DBs
NCBI-ProteinID: BAK80076
Position
complement(1039367..1040215)
Genome map
AA seq 282 aa AA seqDB search
MKSYLLGQYEKSMPSNLSWIDKLTLSREFGFDYLEMSIDETDEKLKRLEWTSHEVKALRD
DIFESKQKINSICLSAHRKFPLGHLDKDMQNRSLDIMEKAINLASDLGVRIIQLAGYDVY
YEESTNETAKIFEENLYKCVELASTKGVMLGFETMETSFMDTVKKAMHYVNIINSPYLGV
YPDIGNLKNASLIYNHSVNDDIKSGEGHIFAAHLKETIPNHYREIEFGRGHTEFKENVTL
LKEMGVRMFNGEFWYVGNDDWREVCVDAVKFLRNILDDVFKM
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctatttactaggtcagtatgagaagagtatgccatcaaatttgagttggatt
gataaacttactttgagtcgtgagtttggatttgattatttagagatgagcattgatgaa
actgatgaaaaacttaagagacttgaatggacttcacatgaagttaaggctcttagagat
gatatttttgagagcaagcagaaaataaattctatatgtttaagtgcacatagaaaattt
cctttagggcatttggataaggatatgcaaaatagatctctagatataatggagaaggct
attaatcttgcaagtgatcttggagtccgaataatacagcttgctggatatgatgtttac
tatgaagagtcaacaaatgaaactgcgaagatatttgaagagaatttatacaaatgtgta
gagcttgcatcaactaagggtgttatgcttgggtttgaaactatggaaacgagttttatg
gacacagttaagaaggcaatgcattatgtgaatataattaatagtccatatcttggagtt
tatccagatatcggaaatcttaagaatgccagccttatatataatcacagtgttaatgat
gatataaagagtggagaaggtcatatatttgcagcacatctaaaagaaacaataccgaat
cattatagagaaatagaatttgggcgtgggcatactgaatttaaagaaaatgttactctt
cttaaagaaatgggagttagaatgtttaatggcgagttttggtatgttggaaatgatgat
tggagagaagtttgtgttgatgctgtaaaatttctgagaaatattttggatgatgtgttt
aagatgtag

DBGET integrated database retrieval system