KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_1144Help
Entry
MOUSESFB_1144     CDS       T01857                                 

Definition
(GenBank) phosphofructokinase family protein
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
asm00010  Glycolysis / Gluconeogenesis
asm00030  Pentose phosphate pathway
asm00051  Fructose and mannose metabolism
asm00052  Galactose metabolism
asm00680  Methane metabolism
asm01100  Metabolic pathways
asm01110  Biosynthesis of secondary metabolites
asm01120  Microbial metabolism in diverse environments
asm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOUSESFB_1144
   00030 Pentose phosphate pathway
    MOUSESFB_1144
   00051 Fructose and mannose metabolism
    MOUSESFB_1144
   00052 Galactose metabolism
    MOUSESFB_1144
  Energy metabolism
   00680 Methane metabolism
    MOUSESFB_1144
Enzymes [BR:asm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MOUSESFB_1144
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MOUSESFB_1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Phage_sheath_1
Motif
Other DBs
NCBI-ProteinID: BAK80286
Position
complement(1291928..1293067)
Genome map
AA seq 379 aa AA seqDB search
MLQLISVYSDIGRITMNQIKKIAILTGGGDCPGLNAVIRAVTKTAILEYGYEVIGYRFGY
RGLYNNDYINLDINAVDNILHKGGTILWSSNKDNLFDYIVEENGQKVKKDVSDIAVDNLK
KENIDALVIVGGDGTLTSARDFARKGVNVVGVPKTIDNDLGATDFTFGFNTAIGIVTDCL
DRLHTTAESHHRILIAEVMGRNAGWIALHAGIAGDAHIILIPEIPYNLDKIVEKINERKA
MGYKYTLIVVSEGAKSVLGETVIAKVVEDSPDPIRFGGIANKLAIDLEKRIPDQEVRSTI
LGHIQRGGNTSTYDRILSTRYGAAAARLIYEGKFGNMVCLDGDEISCIKLEGVIGNEKFV
NPDHELIKISKSMGIGFGD
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttacaattaatctcagtgtactcagatattgggaggattactatgaatcaaataaag
aaaattgcgatacttacaggtggaggagactgtccaggtcttaatgcagttataagagca
gtaacaaaaacagctatattagaatatggatatgaagttatagggtataggtttggatat
agaggtttgtataataatgattatattaaccttgatattaatgcagttgataatatctta
cataaaggtggaactatactttggagttccaataaagataatctttttgattatatagta
gaggaaaatggacaaaaagttaagaaagatgtttcagatatcgctgttgacaatcttaag
aaagaaaatattgatgctttggttatagttggtggagatgggactcttacatcagcgaga
gattttgcccgtaaaggtgttaatgttgtaggtgtacctaaaactattgataatgattta
ggagctacggattttacatttgggtttaatacggcgatagggatagttactgattgtttg
gataggctccatacaacagctgaatcacatcatagaattttaattgctgaagttatgggt
agaaatgcagggtggattgctcttcatgctggaattgctggagatgctcatataatttta
atacctgagataccgtataatttggataaaattgtagagaagattaatgaaagaaaagct
atgggatataaatatactttaatagtcgtatccgaaggagctaagtcagttttaggagaa
actgttattgcaaaagttgttgaggattctccagatccaataaggtttggtggaatagca
aataagcttgcaattgatctagagaagagaataccagatcaggaggttagatcaacaata
cttggtcacattcaaagaggagggaatacttcaacatacgatagaattttatctactaga
tatggtgctgcagcagctagacttatttatgaaggaaagtttggtaatatggtttgttta
gatggtgatgaaatttcgtgtataaagcttgaaggtgttattggaaatgaaaaatttgtt
aatcctgatcatgaattaataaagatatctaagagtatgggaattggatttggagattaa

DBGET integrated database retrieval system