KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_1253Help
Entry
MOUSESFB_1253     CDS       T01857                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
asm00010  Glycolysis / Gluconeogenesis
asm00071  Fatty acid degradation
asm00350  Tyrosine metabolism
asm00620  Pyruvate metabolism
asm00625  Chloroalkane and chloroalkene degradation
asm00626  Naphthalene degradation
asm00650  Butanoate metabolism
asm01100  Metabolic pathways
asm01110  Biosynthesis of secondary metabolites
asm01120  Microbial metabolism in diverse environments
asm01130  Biosynthesis of antibiotics
asm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOUSESFB_1253
   00620 Pyruvate metabolism
    MOUSESFB_1253
   00650 Butanoate metabolism
    MOUSESFB_1253
  Lipid metabolism
   00071 Fatty acid degradation
    MOUSESFB_1253
  Amino acid metabolism
   00350 Tyrosine metabolism
    MOUSESFB_1253
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MOUSESFB_1253
   00626 Naphthalene degradation
    MOUSESFB_1253
Enzymes [BR:asm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MOUSESFB_1253
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MOUSESFB_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: BAK80395
Position
1432371..1434977
Genome map
AA seq 868 aa AA seqDB search
MKSKNQIQEKETSNISLVINSLVNNAKKAEQKLLKLNQNQIDKIVSAMCIAGADKNIELS
KLAIEETKRGVFEDKVIKNLFATEYIHHDIKHIKTVGIINDDPTKDYFNVAEPVGIIAGV
TPVTNPTSTAMFKAIISIKTRNPIIFAFHPSAQKCSSEAARVVYEAAISAGAPEHCIQWI
NEPSIEATNLLMNHPEIALILATGGSGMVKSAYSCGKPALGVGPGNVPAYLEKTCNLQRA
VSDIIISKTFDNGMICASEQTAVVDEEISKYFEKLMKELNCHLCSEDEIKKLEKYAFPED
KNSCVLNANIVGKSANEIAKEAGFEVPEKTKILIAKIDSIGPNSPLSREKLSPILSYIIV
KNSDEGIEKSCQIVEFGGLGHSAAIHSSNEDIIKKFSEKVKAGRIVVNSPSTHGAIGDLY
NSNRASLTLGCGSYGKNSIISNVTCENLINLKRVARRKTNMQWFKIPKKIFFEWGSTSYL
EKMPDISKIMIITDAGMVNLGYADIVVNHLNNRIDKVSIEIFSDVEPDPSVETVFNGVKA
MNRFKPDCIIALGGGSAIDAAKSMWLFYEHPEINFNDIKLKFVDIRKRIYKFPKLGNKAQ
LVAIPTTSGTGSEVTSFSVISDKTKNIKYPLADYELTPNVAIIDPQFVMSLPKSVTADTG
LDVLTHAIEAYVSILASDYTDALAIKAIQLVFEYLPRAFKNGNNDKVAREKMHNASSIAG
MAFTNAFLGINHSLAHKLGGEFHIPHGRANAILLPHVIKFNSETPTKLPSFPKYEKFIAH
EKYAEISRSLGLKASTTEEGVNSLISAIKKLMSELEMPTKISECNINKEEYMSKIELLAL
KAFDDQCTGANPRYPLVEELHEIYKNIY
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaaaaaatcaaatacaagaaaaagaaacttcaaatataagcttagttattaat
tctctagtaaataatgctaaaaaagctgaacaaaaacttttgaaattaaatcaaaatcaa
atagataaaattgtatcagctatgtgtattgctggtgctgataaaaacatagaattatca
aaattagctatcgaagaaactaaacgtggagtttttgaagacaaggttattaaaaacctt
tttgctactgaatacattcatcatgatattaaacatattaaaactgttggaattataaat
gatgatccaactaaagattattttaatgttgctgaaccagttggtattatcgctggggtt
actccagttacaaatccaacatcaactgctatgtttaaagctataatatcaatcaaaaca
agaaatccaataatatttgcattccatccgtccgcccaaaaatgtagttcagaagctgct
agagtagtttatgaagctgctatatctgctggggctccagaacactgcattcaatggata
aacgaaccatccatcgaagctactaatttactaatgaatcatccagaaatagctctcatt
ttggcaacaggtggatccggaatggttaaatctgcatatagttgtggaaaacctgcttta
ggagttggccctggaaatgttccagcttatcttgagaaaacttgtaaccttcagagagct
gtatcagatatcatcatatccaaaacttttgataatggtatgatttgtgcatcagaacaa
actgctgtagtagatgaagaaatctcaaaatattttgaaaaattaatgaaagaattaaat
tgccatttatgttctgaagatgaaattaaaaaactcgaaaaatatgcatttcctgaagac
aaaaactcttgtgtcttaaatgccaatatagtcggaaaatcagctaatgagatagctaaa
gaagctggttttgaagttcctgaaaaaacaaagatattaattgcaaaaatagattctata
ggccctaactctcctctatcacgtgaaaaattaagtcctattctctcatatatcattgtt
aaaaactctgatgaaggaatcgaaaaatcttgccaaatagtcgagtttggaggtcttgga
cattctgcagctattcattcatccaatgaagatattattaaaaagttctcagaaaaagtt
aaagctggaagaatagttgtaaactcaccatcaactcatggagctataggtgatttatat
aattcaaatagagcatccctaacattaggatgtggttcttacggtaaaaattcgataata
tctaatgttacatgtgagaatttaatcaatctaaagagagtcgcaaggagaaaaactaat
atgcaatggtttaaaataccaaagaaaatattcttcgaatggggttctacctcataccta
gaaaaaatgcctgatatatctaaaataatgataattactgatgctggaatggtcaatctt
ggatatgcagatatagttgtaaatcacttaaataacagaatagataaagtaagtattgaa
attttctctgatgttgaaccagatccatctgttgaaactgtatttaatggtgttaaagct
atgaacagatttaaacctgattgtatcattgctttaggtggaggatctgcaatagatgcc
gcaaaatctatgtggttattctatgaacacccagaaataaacttcaatgatataaaacta
aaatttgttgatattagaaaaagaatttacaaattccctaaacttggtaataaagctcaa
ttagttgcaatacctacaacatctggaacaggatcagaagttacttcattctcagtaatt
agtgataaaactaaaaatatcaaataccctctagctgattatgaattaactcctaatgta
gctataatagatcctcaatttgttatgagcttgccaaaatctgttacagcagacactgga
cttgatgttttaactcatgcaattgaagcatatgtttcaatattagcatcagattataca
gatgccttagctataaaagctatacaattagtatttgaatacttaccaagagcatttaaa
aatggaaataatgataaagtcgctcgtgaaaaaatgcataacgcttcttctatagctgga
atggcatttacaaacgcctttctaggtataaatcactcacttgctcataaacttggagga
gaattccatatacctcatggacgtgcaaatgctatactcttacctcatgtaattaaattt
aactctgaaacaccaacaaaacttccatcattccctaaatatgagaagtttattgcacat
gaaaaatatgcagagatttcaagatctctaggacttaaagcttctactacagaagaaggt
gttaatagtctaattagtgctattaaaaagcttatgagtgaacttgaaatgccgacaaaa
atttctgaatgtaatataaataaagaagaatatatgagcaaaatagaattacttgctctc
aaagcattcgatgatcaatgtactggggcaaatccaagatatcctcttgttgaagaatta
cacgaaatatacaaaaatatatactaa

DBGET integrated database retrieval system