KEGG   Alligator sinensis (Chinese alligator): 102367786Help
Entry
102367786         CDS       T02922                                 

Gene name
HSD3B1
Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00140  Steroid hormone biosynthesis
asn01100  Metabolic pathways
Module
asn_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
asn_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102367786 (HSD3B1)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     102367786 (HSD3B1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     102367786 (HSD3B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase GDP_Man_Dehyd NAD_binding_4 Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind KR NmrA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 102367786
NCBI-ProteinID: XP_006028615
UniProt: A0A1U7SAX2
Position
Unknown
AA seq 377 aa AA seqDB search
MSLAGVTCLVTGAGGFLGQRIVHLLLEEEEALAEIRLLDKVFSSETLMNFARYKGKAEVK
ILEGDIRDAAFLHRACQGISLIIHTASIIDILGHVEKQLLWEVNVTGTQLLLEACVHSNV
QYFIYTSSIEVTGPNCRGDPICNGDEETAYESSLTFPYAETKRQAEKHVLKADGQALKAG
GILQTCALRSMYIFGEGSQFLQNHLDQSLLNKNIHLRTSRKEALVNPVYVGNIAWAHMQI
AKALKDPEKAKQIRGQFYYISDDTPPMSYADLDYELTKELGFGIEPQLPMPLVMLYYFAL
LLESLSFLFRPFFRYIPSTNRHLVNLMNTQFTFSYKKAQRDFGYVPHYTWEEAKQRTGQW
IASLIPQRREYLKNKTA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggctggagtgacctgtctggtgacaggagcagggggatttcttggccagaga
attgtccatttactgctggaggaggaggaggcactcgctgagatccgacttctagacaaa
gtctttagctctgagacactcatgaactttgcaaggtacaagggtaaggctgaggtgaaa
atcctggagggggacatccgagatgctgccttcttgcatcgcgcctgccagggcatttcc
ctgatcatccacacagcttccatcattgatatcttgggtcatgtagaaaagcagctgctc
tgggaagtcaatgttacaggtactcagctactgctggaggcgtgtgtccacagtaacgtc
caatacttcatttataccagctccatagaagtgacaggcccaaactgcagaggtgatccc
atctgcaatggtgatgaagaaacagcctatgagagttcactaacatttccatatgccgag
acaaagagacaagcagagaaacatgtcctgaaggcagatggtcaggcactaaaggcaggt
ggcatcttgcagacatgcgccctacggtctatgtacatctttggagaaggaagccaattt
ctccagaatcacctggatcaaagcctcttgaacaaaaatatccacctgcgtacttccagg
aaagaagctttagtgaatcctgtatatgtgggaaacattgcctgggctcacatgcaaatc
gccaaagccctgaaagatccagaaaaagctaagcagatcagagggcaattttactatatc
tcagatgacactccccccatgagctatgcagacctagattatgagctgacaaaggaactg
ggctttggaattgagccccagctgcccatgccactggtaatgctgtactattttgcattg
ctgctggagagcttgagtttcttgttcaggccctttttcagatacatcccctctaccaac
cgtcaccttgtgaatctgatgaacacacagtttaccttctcctacaagaaagcacagagg
gattttggctatgtaccccactacacatgggaagaggctaagcagcgcactggtcagtgg
attgcctcactgattccacagaggagagagtacctgaaaaacaaaactgcctaa

DBGET integrated database retrieval system