KEGG   Alligator sinensis (Chinese alligator): 102368180Help
Entry
102368180         CDS       T02922                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00250  Alanine, aspartate and glutamate metabolism
asn00270  Cysteine and methionine metabolism
asn00280  Valine, leucine and isoleucine degradation
asn00350  Tyrosine metabolism
asn00360  Phenylalanine metabolism
asn00380  Tryptophan metabolism
asn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asn01100  Metabolic pathways
Module
asn_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102368180
   00270 Cysteine and methionine metabolism
    102368180
   00280 Valine, leucine and isoleucine degradation
    102368180
   00350 Tyrosine metabolism
    102368180
   00360 Phenylalanine metabolism
    102368180
   00380 Tryptophan metabolism
    102368180
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    102368180
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     102368180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Pyr_redox Thi4 FAD_binding_3 FAD_binding_2 FAD_oxidored HI0933_like AlaDh_PNT_C MCRA FMO-like IlvN 2-Hacid_dh_C Shikimate_DH Trp_halogenase GIDA Pyr_redox_3 NAD_binding_7 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 102368180
NCBI-ProteinID: XP_006038759
UniProt: A0A1U7SCD6
Position
Unknown
AA seq 507 aa AA seqDB search
MYQFFFLQILLLVTVPSLGFDFSKVKDLKKCFVDPDYEKLVDIAQKGLGQKCNSKKVVIV
GAGISGLTAAKLLKDAGCQVSILEASDRVGGRIVTHRQAGEDWYVELGPMRLPKTHRIVR
TFIEKLKLHLNPFAQSHENGWYFINGIRARAKDVIRNPGILNYTVNESEKGKSAAQLYSE
AMYKAVEKLYKWSCNEIWEKYDTFSTKEYLIKEGGLSRGAVQMIGDLMNRDSSFHISFLS
SVTDYVAFLQVGFDEITGGFSNLPRAFHKSLPGVVRFNSPVVKIVRNGDGATVYYRTVNT
KGVSSVTADYVLVTATARAARLIQFQPTLSYNKTDALRSIHYAAATKIALICTEKFWEKD
GIPGGQSITDQPARFIYYPDHKFPSGLGVILASYTVNDDAEFFTSLSNERCLDVVLDDLA
AVHNISKAYLQRVCKKHVVKKWNMDEYAMGAFAAFTPYQFIDFYKVLFENEGRIHFAGEH
TGFPHAWIDTAMLSALKASLNIYKGVH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagttcttttttctgcagatcttgctccttgtgacggtaccaagccttggcttt
gacttcagcaaagtgaaggacctgaaaaaatgcttcgttgatcctgactatgaaaaactg
gtcgatattgcccaaaaagggctaggacagaagtgtaattcgaagaaggtagtgattgtt
ggggcaggaataagtggactcaccgctgccaaactgcttaaagatgctggttgccaggtc
tcaatcctggaagccagcgatcgcgtgggaggacggattgtgacccatcgtcaggcagga
gaagattggtatgtggagcttggaccaatgcgcttgccaaagacccacagaattgtccga
acttttattgaaaaactaaagcttcatttaaacccgtttgctcagagccatgaaaatggc
tggtattttattaatggtatcagagcaagagctaaagatgtcatccgaaaccctggaatc
ctgaactataccgtgaatgagtcagagaaaggaaagtctgctgctcagctatattcagaa
gcaatgtacaaggcagtagagaaactctacaaatggagctgcaatgaaatctgggaaaaa
tatgacaccttttctaccaaggagtatttgattaaagaaggaggactaagtcgaggggcc
gtgcagatgattggtgacttgatgaatagggattcttccttccacatctctttcctaagc
tcggtcactgactatgttgccttcctacaagtcggttttgatgagatcactgggggattc
agtaatttgcccagagctttccacaagtctctgcctggagtggtccgttttaactctcct
gtagtgaaaatagtgagaaacggtgacggagctaccgtgtattaccgtacagtcaacaca
aaaggtgtctcttcagtgactgctgactatgttcttgttacggccactgcaagagcagca
cgactcatccaatttcaacctacactttcctacaacaagacggatgctctgcgctccatt
cactacgccgctgccaccaaaatcgctctgatctgcactgaaaaattctgggaaaaggat
ggcatcccgggtggtcagtcaatcacggatcaacctgccagattcatctactaccctgac
cacaaattccccagtgggttgggagtgatcctcgcttcctacacagtgaatgatgatgct
gaatttttcacttccctcagcaatgagaggtgcctggatgtggtcctggatgacctggca
gcagtccacaacatctctaaggcttacctacagagagtgtgcaagaagcacgtggtgaag
aaatggaacatggacgagtatgccatgggggcctttgctgcctttaccccataccagttt
atagatttctacaaggttttgtttgagaatgagggcagaatccattttgctggggaacac
acaggctttccacatgcctggattgacactgctatgctatctgctttgaaagcttcgttg
aacatctataagggtgtccactaa

DBGET integrated database retrieval system