KEGG   Alligator sinensis (Chinese alligator): 102369090Help
Entry
102369090         CDS       T02922                                 

Gene name
MAOA
Definition
(RefSeq) amine oxidase [flavin-containing] A
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00260  Glycine, serine and threonine metabolism
asn00330  Arginine and proline metabolism
asn00340  Histidine metabolism
asn00350  Tyrosine metabolism
asn00360  Phenylalanine metabolism
asn00380  Tryptophan metabolism
asn00982  Drug metabolism - cytochrome P450
asn01100  Metabolic pathways
Module
asn_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102369090 (MAOA)
   00330 Arginine and proline metabolism
    102369090 (MAOA)
   00340 Histidine metabolism
    102369090 (MAOA)
   00350 Tyrosine metabolism
    102369090 (MAOA)
   00360 Phenylalanine metabolism
    102369090 (MAOA)
   00380 Tryptophan metabolism
    102369090 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102369090 (MAOA)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102369090 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Salt_tol_Pase
Motif
Other DBs
NCBI-GeneID: 102369090
NCBI-ProteinID: XP_006015701
UniProt: A0A1U7R914
Position
Un
AA seq 502 aa AA seqDB search
MSAAKLLSDSGLSVVVLEARDRVGGRTFTIRNKQVNYVDVGGAYVGPTQNRILRLAKELG
IETYKVNIEERVIYHVKGKSYPLYGLFPTVWNPLVYLDYNNLWRKMDEMGKEIPAEAPWD
APHAAEWDKMTMKELISKICWTKAARDFATLFVNVNVTSEPHEVSALWFLWYVKQCGGTT
RIFSVTNGGQERKFVGGSGQITEKIMQRLGGRVKLERPVVHIDQSGENVIVQTLNHEKYE
GKYVISAIPPGLTTKIHFNPELPTKRNQLIQRLPMGSVIKCMVYYKEAFWRKMDYCGSMV
IEDEEAPISITLDDTKPDGSVPAIMGFILTRKAFKLVHLSKEERKKKICELYAKVLGSEE
ALHPVHYEEKNWSAEQYSGGCYTVYFPPGIMTQYGRIIRESFGRIYFAGTETATQWSGYM
EGAVQAGERAAREILCKMGKISESEIWKSEPESKDVPALPITTTFWERNLPSLPGLLMLV
GVFTPMAALGLFAYKKGLLFRN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagccaaactactgtctgactctggccttagtgttgtggttctggaggcccgt
gacagagttggaggaaggaccttcactattaggaacaagcaagtaaattatgtagatgtt
ggtggtgcatatgtaggacctacccaaaaccgcatccttcggctggccaaggagctgggc
atagaaacatacaaagtgaatatagaagagagggtaatctaccatgtgaagggaaagtcc
tatccactctatggtctgtttcccacagtttggaatcccttggtttacttggattataac
aatctatggaggaaaatggatgaaatgggcaaagagatccctgctgaagcaccatgggat
gctccacatgctgcagagtgggacaagatgacaatgaaagagctcatcagcaaaatttgc
tggactaaagctgccagagactttgctactctctttgtgaacgtcaatgtcacttctgag
ccacacgaggtctctgctctctggttcctgtggtacgtgaagcagtgtgggggaacaacc
aggatattttccgtaaccaatgggggccaggagcggaagtttgttggaggctctggtcag
attacagagaagataatgcaacgccttggaggaagagttaaactggagagacctgtagtc
cacattgatcagtcaggtgaaaatgtcattgtgcagacactaaaccatgagaaatatgag
ggcaagtatgtgatcagtgctattccccctggcctgactacaaagatccatttcaaccca
gaattaccaacaaagagaaaccagttaattcaacgtcttcctatgggctctgtcatcaaa
tgcatggtgtactacaaggaagccttctggagaaagatggattactgtggcagcatggtc
attgaggatgaagaagctccaatttcaataaccttagatgacactaaacctgatggatct
gtgcctgccattatgggttttatccttacaagaaaggcctttaagctggtgcatcttagc
aaggaagagaggaaaaagaaaatctgtgagctgtatgccaaagtgctgggttcagaagag
gctttacatccagtgcattatgaagagaagaactggagtgcagaacagtattcaggtggc
tgttatacagtctacttcccaccaggcataatgactcaatatggaaggatcattcgagag
tcatttggcaggatctactttgctggcacagagacagctacccagtggagcgggtacatg
gaaggagctgtgcaggctggggagagagcagcaagggagatactgtgcaagatgggaaag
atctcagagagtgaaatctggaagtctgaaccagagtcaaaggatgtcccagccctgcca
atcactactaccttttgggagaggaacctgccatctctaccaggactactgatgctagtt
ggagttttcacacccatggctgctcttgggctgtttgcttacaaaaaggggctgctattt
cgaaactga

DBGET integrated database retrieval system