KEGG   Alligator sinensis (Chinese alligator): 102369936Help
Entry
102369936         CDS       T02922                                 

Gene name
ETNPPL
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase isoform X1
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00564  Glycerophospholipid metabolism
asn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102369936 (ETNPPL)
Enzymes [BR:asn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     102369936 (ETNPPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 HGD-D
Motif
Other DBs
NCBI-GeneID: 102369936
NCBI-ProteinID: XP_006031315
UniProt: A0A1U7RY61
Position
Unknown
AA seq 497 aa AA seqDB search
MSEVYSKAETLALRRKHIGPSCKVFFAKDPLKIVRAQGQYMFDENGEKYLDCINNVAHVG
HSHPDVIKAAVKQMELLNTNSRFLHDNLVQYAKRLTDTMPEKLCVCYFVNSGSEANDLAL
RLARHFSGHQDVITLDNAYHGHVTSLIDISPYKFNQLGKESKKEFVHVAPSPDTYRGKYR
EDHLDPAGAYAGEVKKIIEETQKNGRKIAAFIAESMQSCGGQVIPPAGYFQQVAEYVHEA
GGVFIADEVQVGFGRVGKHFWAFQLQGEDFVPDIVTMGKPIGNGHPMSCVVTTREIAEVF
GASGLEYFNTFGGNPVSCAIGLAVLDVIEKEDLQGNATRVGNYLIELLNEQKRKHPLVGD
IRGVGLFVGVDLVKDEQKRTPATAEALHLVYKLKERHILLSADGPHRNILKFKPPMSFTR
EDAKFVVDQIDALLTEMEEATGNKISTNMQCKRKTNEENLQSDCLGESINHVNGNACRQE
NGFYADNHVVPCKRIRT
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggtgtacagcaaggcggagaccctggcgctgcggaggaagcacatcgggccc
tcatgcaaagttttctttgctaaggaccctctcaagatagtgcgagctcagggacagtat
atgtttgatgaaaatggagaaaaatacctggactgcatcaacaatgttgcacatgttggc
cacagccatccagatgtcataaaggctgcagtgaaacaaatggaattgctcaacacaaat
tcccgattcctccatgacaatcttgtccagtatgccaagcgacttactgataccatgcca
gaaaaactctgtgtctgctattttgttaattctgggtctgaagctaatgaccttgctttg
cgactagctcggcattttagtggacatcaagatgtgatcacccttgataatgcttaccat
ggccatgtcacttctttaattgacatcagtccatataaatttaaccagttgggaaaggaa
agcaaaaaggagtttgtgcatgtggcaccttcaccagatacctacagaggcaaatacaga
gaagatcatctggatccagccggtgcttacgctggggaggtgaaaaagattatagaagaa
actcaaaagaatgggcgcaagattgctgcctttattgctgaatcgatgcagagttgtgga
ggccaagtaattccacctgcaggctacttccagcaagtggcagaatatgtgcatgaggca
ggtggtgtattcatagctgatgaagtccaggttggttttggtcgagttggaaaacatttt
tgggctttccagctacaaggggaagactttgtacctgatattgtcaccatgggaaagcca
attggcaatggccatccaatgtcttgtgtcgttacaacaagagagattgctgaagtcttt
ggtgcctcagggttagagtatttcaatacatttggaggcaatccagtgtcttgtgctatt
ggcttggctgtactggatgtaattgaaaaagaagatcttcaagggaatgccacacgagta
ggaaattacctaatagagctgctgaatgaacaaaagagaaaacatcctttagtgggagat
atccggggtgttggtttgtttgttggagtagatcttgtgaaggatgaacagaaaaggaca
ccagccacagcagaagcccttcatcttgtctataaactaaaagaacggcacatcctcctt
agtgcagatggaccccacagaaacattctgaaatttaaaccaccaatgagtttcactcgg
gaagatgcaaagtttgtagtagaccaaattgatgcactactcacagaaatggaagaggca
actggaaacaagatatctacaaacatgcagtgtaaaagaaaaactaatgaggagaatctc
cagtcagactgtctcggtgaaagcatcaaccatgtcaatggaaatgcctgcagacaagaa
aatggcttctacgctgataaccacgttgtgccttgtaaaaggatcagaacctga

DBGET integrated database retrieval system