KEGG   Alligator sinensis (Chinese alligator): 102370421
Entry
102370421         CDS       T02922                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asn03036]
    102370421 (ANKRD53)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    102370421 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank
Other DBs
NCBI-GeneID: 102370421
NCBI-ProteinID: XP_025069071
UniProt: A0A3Q0HAH3
Position
Unknown
AA seq 464 aa
METRVQIGRRGKIIEKKGPQKPEKSSKASKADDRQLPATSKGTVPWLQQCLQKAEMRAQA
DANEQIAARGHSDVLLLTSSPLQGFSVIHSAALNGRLDCLKTIVEKYEVDVNLPSLKGWR
PIHLVMNKESGPRALECLQYLIGKGADVNIQSQTGASPLHKAASEGRLPCIVALVEAGAD
IFAKDAKGHVPVDLCKLWAHRSCARYLTDAMWKKTKRNLAQEMHKLQQIKSEWQCTEAAL
VTREKMEKAMLNRMAFSDWLQKKQQRPSLRTLQEEPFPEDSADLGALPSTLAAKTPSEEE
LMWVDSAPRFPDLVQLPLEQAPPPWNASTNPSSPPVADIYRATTVRLGAEPEASPEHDFS
AFLHLSKDPRGRPLVRSAHGGRLASLPELPYDIVRRSIFPSSRPVRMKGPQDFRPAHILG
VPRKRLPHGPWRWTDEMAMSLRETLDPEFVATVRAHLAAYDESN
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggagaccagggtgcagataggaagaagagggaagatcatagagaaaaaaggtcctcag
aaaccagagaagagttcgaaggcctccaaggcagatgatcgccagctgccggccacctcc
aagggcaccgtgccctggctccagcagtgcctgcagaaagcggagatgcgcgcccaagcc
gacgccaacgagcagatagctgcccggggccattcagacgtgctgctcctcacctcctct
cccctgcaggggttctcggtcatccactccgcggcactcaatggccggctggactgcctg
aaaaccatcgtcgagaaatacgaggtggacgtgaacttgcccagcctgaaaggatggaga
cccattcacctggtgatgaacaaggagagcggtcccagagccttggagtgcctgcagtac
ctcatcgggaagggggccgacgtgaacatccagagccagaccggagcgagtccccttcac
aaggcagccagcgaaggacgcctcccgtgcattgtcgcgctggtggaagccggagctgac
attttcgccaaggatgcaaagggacacgtgcctgtagacctgtgcaagctgtgggcacac
agaagctgcgcgaggtacctgacggacgccatgtggaaaaaaaccaagaggaatttggct
caggaaatgcacaagctccagcagatcaagagcgagtggcagtgcaccgaggcggccttg
gtcacgagggagaagatggaaaaggccatgctgaacagaatggctttctccgactggctc
cagaaaaagcagcagcggccctcacttcgcacccttcaggaagagcctttccctgaggac
agcgcagacctgggcgctctccccagcacgttagcagccaaaaccccttccgaagaagag
ctgatgtgggtggattcagccccgcgtttccccgatctcgtccagctgcccctcgagcag
gcgccgccaccgtggaacgccagcaccaacccctcgtccccgccggtggcggacatatac
cgcgccacgaccgtgaggctgggcgccgagcccgaagccagcccggagcatgatttcagc
gccttcctgcacctctccaaggacccgcgtggccggccgctagtccgttctgctcacgga
ggccgactggcctccctccctgagctgccctacgacatagtccggaggagcatcttcccc
tcgtctcggccggtccgaatgaaggggccgcaggacttccgacccgctcacatcctgggc
gtccctaggaagcgcctcccgcacgggccgtggcggtggacggacgagatggccatgagc
ctgcgggaaacgctggacccggagttcgtagccacagtcagggctcatctcgccgcctac
gacgaaagcaactaa

DBGET integrated database retrieval system