KEGG   Alligator sinensis (Chinese alligator): 102371219Help
Entry
102371219         CDS       T02922                                 

Gene name
MTM1
Definition
(RefSeq) myotubularin isoform X1
  KO
K01108  myotubularin [EC:3.1.3.64 3.1.3.95]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00562  Inositol phosphate metabolism
asn01100  Metabolic pathways
asn04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102371219 (MTM1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102371219 (MTM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:asn01009]
    102371219 (MTM1)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     102371219 (MTM1)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     102371219 (MTM1)
Protein phosphatases and associated proteins [BR:asn01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    102371219 (MTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase DSPc 3-PAP Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 102371219
NCBI-ProteinID: XP_006024706
UniProt: A0A1U7RRN8
Position
Unknown
AA seq 603 aa AA seqDB search
MASSSTPKYNSNSLESSSVKRTPKDGTNWEQNEEIPRLPGETRITDKEVIYMCPFNGPIK
GRVYITNYRLYLRSVEKESIVILDVPLGVISRIEKMGGASSRGENSYGLDITCKDMRNLR
FALKQEGHSRRDIFEVLTKYAFPQSHNLPFFAFVNEEKFSENGWMVYNPMSEYRRQGLPS
DRWRVTFINEHYSLCDTYPSLLVVPYCATEDDLKKVAAFRSRNRIPVLSWIHPENQAVIM
RCSQPLVGMGGKRNKDDEKYLDIIREANGQISKLTIYDARPNVNAVANKATGGGYESEDA
YPNAELFFLDIHNIHVMRESLKKLKDIVYPNVEESHWLSSLESTHWLEHIKLVLTGAIQV
ADKVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSYYRTVVGFEVLVQKEWISFGHKFAS
RIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNEQFLITILDHLYSCRFGTFLY
SCESARDREKVAEKTLSLWSLINSEKAKYINPFYTKELNRALYPVASMRHLELWVNYYIR
WNPRIRQQQPNPVEQRYMELLALRDDYVRRLEELQITNNTKISSSSTSSASPSQMVSHVQ
THL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatcatcgacacctaaatataattccaactccctggaaagctcctcagttaaa
aggaccccaaaagatggaactaactgggaacaaaatgaggaaatacctcgtctaccagga
gaaaccagaattacagataaagaagttatctacatgtgtccattcaatggtcccattaaa
ggaagagtgtacatcacaaactataggctctacttaagaagtgtggaaaaagagtcaatt
gtgatattggatgttcctttgggtgtaatttcaaggattgaaaaaatgggaggagcttca
agtagaggcgagaattcctatggactagatataacttgtaaagatatgagaaatctacgg
tttgcactgaaacaagaaggtcatagtagaagagatatatttgaagtccttacaaaatat
gcttttcctcagtctcacaacttgcctttttttgcatttgtaaatgaagagaagttttct
gaaaatggttggatggtttataacccaatgtccgaatacaggagacaaggcttgcccagt
gaccggtggagagtaacttttatcaatgaacattacagcctgtgtgacacatatccatca
cttttggtagtcccatattgtgctacagaagacgatcttaagaaggttgctgcatttagg
tcccgaaatagaattccagtgctgtcatggattcatccagaaaatcaagctgttattatg
cgctgcagtcagcctctcgtaggtatgggtggtaaacggaataaggatgatgaaaagtat
cttgatatcatcagggaagcaaacggacaaatatcaaaactaaccatctatgatgcaagg
cccaatgtaaatgcagtagctaacaaggcaactgggggaggatatgaaagtgaagatgca
tatcccaatgcagaactttttttcttagatattcataatatccatgtcatgagggaatct
ttaaaaaagctgaaggacattgtttatcctaacgtagaagaatctcactggttgtcaagt
ctggaatcaactcattggctagaacatatcaaacttgtcttgacaggagctattcaagtg
gcagataaggtgtcctcagggaagagctctgtgctggtacattgtagtgatggttgggac
cgaacagcacaactaacgtctctggccatgttgatgttggacagctactacagaacagtt
gtgggttttgaagttctggtacaaaaggagtggatctcttttggacacaaatttgcatcg
agaataggccatggcgataaaaaccatgctgatgctgatagatcacctatctttttgcag
ttcattgattgtgtttggcaaatgtctaaacagtttcctacagcttttgaattcaatgaa
caattcttgattacgattctggatcacttgtacagctgccgatttggtacttttttgtac
agctgtgagtctgccagagacagagagaaagtggctgaaaaaacactgtcattatggtcg
ttgataaacagtgaaaaggccaagtacatcaatcctttttatactaaagaactgaatcga
gcactttatccagtagccagtatgcgtcacctggaactttgggttaattattacattagg
tggaacccaaggattcggcaacaacagccaaatccagtggagcagcgttacatggagctg
ttagctttacgtgatgactacgtgaggagactcgaagagctgcagatcacaaataatact
aagatctccagttcatcaacctcatcagcatctccatcgcagatggtgtcccatgtgcaa
acacatttatga

DBGET integrated database retrieval system