KEGG   Alligator sinensis (Chinese alligator): 102372195Help
Entry
102372195         CDS       T02922                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04136  Autophagy - other
asn04140  Autophagy - animal
asn04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102372195 (ATG16L1)
   04136 Autophagy - other
    102372195 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102372195 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:asn04131]
    102372195 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:asn03029]
    102372195 (ATG16L1)
Membrane trafficking [BR:asn04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    102372195 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    102372195 (ATG16L1)
Mitochondrial biogenesis [BR:asn03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102372195 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 eIF2A Ge1_WD40 ERM ZapB WD40_like DUF2332 Peptidase_M15_4 Fez1 Leu_zip FlaC_arch V_ATPase_I DUF4407 HALZ PALB2_WD40 HAUS-augmin3 AAA_13 KASH_CCD
Motif
Other DBs
NCBI-GeneID: 102372195
NCBI-ProteinID: XP_025065230
UniProt: A0A3Q0H4B2
Position
Unknown
AA seq 491 aa AA seqDB search
MQQKDREMQLNEAKIAEYLQKISELETECQELRNKLQDLEQANQTLKDEYDALQITFNAL
EEKLRKTTEDNQELVSRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLSVEQ
DDDIEVLADETSDPAEETSPVRAVSRTSSKRFSQPTGGLLDSITNIFGRRSLSSFPIPQD
NVETHPVSSKEVRVPSTAVCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGDKC
ELKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVMSAKF
LLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKVRFWDI
RSESIVQELELLGRITALDLNPERTELLTCSRDDLLKIFDLRVNAVKQTFSAQGFKCGSD
WTRVVFSPDGSYVAAGSADGTLYIWNVLTGKVERALAKHHSSSINAVAWSPAGAHVVSVD
KGNKAVVWSEF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagaaagaccgagagatgcagctgaatgaagcaaaaattgcagagtatttgcaa
aagatctctgagctggaaacagagtgccaggagttacgcaacaaactgcaggatcttgag
caagctaatcaaacattgaaggatgagtatgatgcccttcagatcacctttaatgctcta
gaagagaaactgaggaaaaccactgaagacaaccaagagctggtctcacgttggatggca
gaaaaggctcaggaagccaatcgtctcaatgcagaaaatgagaaagattcaaggagacgg
caagccagactgcagaaagaactggcagaagctgccaaagaacctctgtctgttgaacag
gatgatgatattgaagtccttgctgatgaaacctctgacccagctgaggagacatcccca
gttcgagctgtgagccggacttccagtaagcgattctcccagccaactggaggccttctg
gactctatcactaatatctttgggaggcgctctctgtcctcattccccatcccccaagac
aatgtagagacgcatccagtctccagcaaagaagtgagagtgcccagtactgctgtatgt
gtttttgatgcacatgatggggaagtgaatgcagtgcagttcagtcctggctctcggtta
ctagcaacaggaggcatggatcggagggttaaactctgggaggtctttggagataagtgt
gagctaaagggctccctctccggtagtaatgcaggaattacaagcatcgagtttgacagt
gctggctcttaccttttagcagcttcaaatgactttgccagcagaatctggacagttgat
gactatcggttacggcacaccctgacaggtcacagtggtaaagtcatgtctgccaagttt
ttgttggacaatgcgcgtattgtttctgggagtcatgaccggaccctcaagctttgggac
ctgcgcagcaaagtttgtataaaaacagtgtttgcaggatctagctgcaatgatatagtc
tgcactgagcagtgtgtaatgagtggacattttgacaagaaagttcgcttctgggacata
aggtctgaaagcatagtacaggagttggaactgcttgggaggatcactgctttagacctg
aatccagagagaacagagctcttaacctgttcccgagacgatttgctgaagatctttgat
ctacgggttaatgctgtcaaacagaccttcagtgcccagggattcaaatgcggatctgac
tggaccagagttgtattcagccctgatggcagctacgtggcagctggttcagctgatggg
accctgtacatttggaatgtgctcactgggaaggtggagagagctcttgcaaagcatcac
agctcctctatcaacgcagtggcatggtcaccagccggtgctcatgtggtcagtgtggac
aaaggaaacaaggctgtcgtgtggtctgaattttga

DBGET integrated database retrieval system