KEGG   Alligator sinensis (Chinese alligator): 102373545
Entry
102373545         CDS       T02922                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:asn01009]
    102373545 (AKAP5)
Protein phosphatases and associated proteins [BR:asn01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102373545 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102373545
NCBI-ProteinID: XP_006018736
UniProt: A0A1U7RQX3
Position
Unknown
AA seq 488 aa
MEKAAKDIQTENTAESEMQSAAKLCPPAEEEAEKPSMFCFKKRKKSGKKASDVKGTCEEE
SANLNQTSQRSADHREGKASDPSQSPKGAWAAIKCFVRPRRKLKSSSRKHVPSDSQVQLE
TSTEEAGLQSLPKKEVRSGLKIPCIRFSSGKTKPSQCEMTEESDDSIKGNEAMGILNKAT
SEPEGLATAVKSSPDRSFGQSAAKKDSDSTAEKSDSSAGENELLQEPRPDTDQHTGCPVQ
SETMNLETVAVIVQEKQCPRSQPETAVHTVTKQDDGNTTFGAEPPEDLPEHVPRVTEVQG
RNAMPEKQPGLDEFGSSISVSEDCKSKETIMGSNQSAFRDEAANVQSCSNKQFKLEESKD
VDGVGIVITVTDADDCDEVEPSYICKLPLIPRHTKPKGNKKSGNFDFSSFSDCQQGSVAG
SGHWREDKNSSHALSPKGLSDQGQRTSEQYELLLIETASSLVKAAIQSSIEQLVNEMALE
HNKQNSFL
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggagaaggcagctaaggatattcaaacggaaaacacagcagagtcagaaatgcagagt
gcagcaaaactgtgccctccagctgaagaagaggcagaaaaaccctccatgttttgtttt
aagaaaagaaagaagtcaggcaagaaggcttcagacgtgaagggtacctgcgaagaagag
tctgcaaacttgaatcaaaccagccagcgcagtgcagaccacagagaagggaaagcttca
gatccgtctcagtcaccaaaaggagcctgggcagctataaaatgttttgtgagaccaagg
agaaagttaaagtcttcttccagaaaacacgtaccttccgactctcaagtccagctggag
accagtacagaggaggctggcttgcagagtttgcccaagaaagaggttcgttctggtctg
aaaataccatgcataaggttttcaagtggcaagacaaaacccagccagtgtgaaatgaca
gaggaatcagatgacagtattaagggaaatgaagcaatgggcattttgaataaagctacc
agtgaacccgagggtttggcaactgcagttaaatctagccctgatcgatccttcggccag
tctgctgcaaagaaagacagtgacagtacggctgaaaaaagtgacagttctgctggggag
aacgagcttttgcaagaacccaggccagacaccgatcaacacacaggatgtcccgtccag
tcagaaacaatgaatttagagacagttgctgtaatagtccaggaaaagcagtgtccgagg
agccaaccagaaacagcagtgcatacagtaacgaagcaggatgatggcaacactacgttt
ggtgctgagccgcctgaggacctaccagagcatgtacctagagtcaccgaggtacaaggt
agaaacgccatgcctgagaagcagcctggactggatgagtttggaagcagcataagcgtt
agtgaggactgtaaatccaaagagacgataatgggttccaatcagtcagcatttagagat
gaggcagcaaatgtacagagctgttcaaataaacaatttaaattagaagaaagcaaggat
gttgatggggtgggcattgtgattacggttacagatgcagacgattgcgatgaagtggag
cccagctatatctgcaagctgcccttgatcccacgtcatacaaaacccaaagggaataag
aaaagtgggaactttgatttcagtagcttttcagattgccaacagggctcagtggcaggc
agcggccactggagggaggataaaaacagttcccatgctctctcacccaaaggtctcagt
gatcaggggcaaagaacttcagagcagtatgaattgcttctgatagaaaccgcatcttca
cttgtaaaagcagctattcagtcatccatcgaacagctggttaacgaaatggctttggaa
cataataaacagaacagttttctctga

DBGET integrated database retrieval system