KEGG   Alligator sinensis (Chinese alligator): 102374362Help
Entry
102374362         CDS       T02922                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X8
  KO
K09052  cAMP response element modulator
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:asn00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102374362 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asn03000]
    102374362 (CREM)
Transcription factors [BR:asn03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102374362 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5 Phage_Gp23 DUF4988
Motif
Other DBs
NCBI-GeneID: 102374362
NCBI-ProteinID: XP_006036644
UniProt: A0A1U7SRF9
Position
Unknown
AA seq 108 aa AA seqDB search
MAVTGDETAATGDMPAYQIRTPTTALPQGVVMAASPGTLHSPQQLAEEATRKRELRLMKN
REAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacaggagatgaaacagctgctactggagacatgccagcttatcagatccga
actcctaccactgccttgcctcaaggagtggtaatggcagcatcaccgggaacattgcac
agccctcagcagctagcagaggaggcaacacgcaaaagagagctaagactcatgaaaaat
agggaagctgcccgggaatgtcgcagaaagaagaaggagtatgtcaaatgtcttgaaaat
cgtgtggctgtgcttgaaaaccaaaacaagactctcattgaggaactcaaggccctcaaa
gatctttattgccataaagcagaataa

DBGET integrated database retrieval system