KEGG   Alligator sinensis (Chinese alligator): 102374989Help
Entry
102374989         CDS       T02922                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00600  Sphingolipid metabolism
asn01100  Metabolic pathways
asn04020  Calcium signaling pathway
asn04370  VEGF signaling pathway
asn04371  Apelin signaling pathway
Module
asn_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102374989 (SPHK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102374989 (SPHK2)
   04371 Apelin signaling pathway
    102374989 (SPHK2)
   04020 Calcium signaling pathway
    102374989 (SPHK2)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     102374989 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 102374989
NCBI-ProteinID: XP_025063571
UniProt: A0A3Q0GUV8
Position
Unknown
AA seq 602 aa AA seqDB search
MGPETVAGTGRMELAPGPYHNGAETLLHGEFGIYPSKGTRYALSLTCTELHIQRLVPKPE
TDQRTVVALADVVGCHTLRSRVTTDCAAYFTVYAYPLKKRKVAMGSGRARQRTARTFQVD
GADNYNKNQAMAEKWAVAIKCLVLGVPVSSETDISLSLLPRPRRLLLLLNPFGGRGNALQ
WCQSHILPMISEADISFNLIQTERANHARELVKGISLPEWDGIVTLSGDGLLYEVINGLM
ERPDWEQAITMPVGILPCGSGNALAGAINFNAGLEQAMGLELLQNCTVLLCHAAVAPLDL
VSVTMASGTRCFSFLSVAWGFVSDVDIESEKYRRVGSARFTLGTMVRLASLHTYRGRLSY
LPAPDGPAHRPISRSITVAANGRLPLTRLPLHRAVSDMGLCEERQAFRHRGPEPPDDPSP
SPGSPPPISASALHPQSFIFEPAPEEPIGAPEGGGMDTGMGGPPDDLLVPLGQPVPPSWV
TVEDDFVLVLAIYQTHLGADLLTAPFACLSDGLIHLCFVKAGVSRAALVRIFLAMEKGTH
FEQACPHLSHVPVRAFRLEPLTRKGILTVDGERVEYGPLQAQVHCGLARLITGVARLGGS
SC
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggggccagagactgtggcaggaacgggaaggatggagctggctccagggccataccac
aatggtgctgagacgctgctgcatggcgagtttgggatctacccctcaaagggcacacgc
tatgctttgagccttacgtgcacggagctgcacatccagcgcctagtgcccaagcccgag
acagaccagcggacagtggtagcgctggctgatgtggtgggctgtcacacactccgaagc
cgggtgaccactgactgtgctgcctacttcacggtctatgcctacccactgaagaagagg
aaggtggcaatgggctcgggccgggcgcgccagcggacagcacgcaccttccaggtggat
ggggctgacaactacaataagaaccaggccatggctgagaagtgggcagttgccatcaag
tgcctagtgctgggtgtccctgtctccagtgaaacggacatcagcctgagcctcctgccc
aggcctcggcgcttgctgctgctcctgaacccttttggtggccggggcaatgccctgcag
tggtgccagagccacatcctgcccatgatctcagaggctgatatcagcttcaacctcatc
caaacagagcgagcaaaccatgcccgggagctggtgaaaggcatcagcctgccagagtgg
gatgggatcgtcaccctctctggggatgggctcctgtatgaggtcatcaatgggctgatg
gagcggccagactgggagcaggccatcaccatgccggtgggcatcctgccctgcggctca
gggaatgccctggctggagccatcaacttcaatgctgggctggagcaggcaatgggcctg
gagctgctgcagaactgcacagtgctgctgtgtcacgcggccgtggcacccctggacctg
gtgtcagtgacgatggcatcaggcacccgctgcttctccttcctcagtgtggcctggggc
tttgtctcagatgtagacatcgagagtgagaaataccggcgcgtgggctcggcccgcttc
acactgggcaccatggtacgcctggcttccctgcacacctaccgtggacgcctctcctac
ctgcctgcgcctgatggcccagcccaccgccccatttcccgcagcattactgtggctgca
aatgggcgcttgcccctgacgcgcctgcctctgcaccgtgctgtctcagacatgggcttg
tgcgaagagcgccaggccttccgccaccgtggacctgagccccctgatgacccttcccca
tccccggggtccccccctcctatctcggcctcagccctgcacccccaaagcttcatcttt
gagccggcacctgaggagccgataggtgccccagaaggcgggggcatggacacaggcatg
ggtgggcctccagatgacctgctggtgcccctggggcagccagtgcccccatcatgggtg
actgtggaggatgactttgtgctagtcctggccatttaccagacacacctgggtgctgac
ctactcacagcacccttcgcttgcctcagtgatgggcttatccacctctgctttgtcaaa
gctggggtgtcacgtgccgctcttgtccgtattttcctggccatggagaagggcacccac
tttgagcaggcctgcccccacctcagccatgtacctgtgcgcgccttccgcctggagccc
ctcacacgcaagggcatcctcaccgtggacggtgagcgcgtggagtatggccccctccag
gcccaggtgcactgcggccttgcccgtctcatcactggtgttgcccgccttgggggctcc
tcctgctga

DBGET integrated database retrieval system