KEGG   Alligator sinensis (Chinese alligator): 102375223Help
Entry
102375223         CDS       T02922                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00500  Starch and sucrose metabolism
asn01100  Metabolic pathways
asn04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102375223 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102375223 (GYS2)
Enzymes [BR:asn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102375223 (GYS2)
Glycosyltransferases [BR:asn01003]
 Polysaccharide
  Storage polysaccharide
   102375223 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 102375223
NCBI-ProteinID: XP_006027406
UniProt: A0A1U7SB28
Position
Un
AA seq 704 aa AA seqDB search
MPLVRSLSMTSLNGLPLWEDEDLLVEDLLLFEVSWEVTNKVGGIYTVIQTKARITADEWG
ENYFLMGPYFEHNVKTQVEVCEPLNPAIKKAVETMKGQGCQVFFGRWLIEGSPYVVLFDI
ASAAWNLDRWKGEFWDASNIGIPFQDREANDAVIFGSLTAWFLKEISSQIDDKPNIIAHF
HEWQAGVGIILTRFRKLPVATIFTTHATLLGRYLCAANIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITATEAEHMLKRNADVVTPNGLNIKKFSATHEFQNLHIM
YKARIQEFIRGHFYGHLDFNLENTLFFFIAGRYEFSNKGADIFLEALSRLNFLLRVHKSD
TTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGKKLYDALLRGEIPDLNKI
LDRDDITIMKRAIFATQRQTLPPVTTHNMLDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSASPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMR
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRYYMHARHLALSRAFPEKFEMEPSAPPKTEGFRYPRPSSVPPSPSVSQPSSPHQSDE
EDEDEDERYDEDEEAERDKQNIKAPFSLGIMPPGKKQQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggttagatccctatccatgacgtctcttaatgggcttcccctgtgggaggat
gaagacctgctagtggaagatttattactttttgaagtctcctgggaagttaccaacaaa
gttggtggcatctatactgtgatccagaccaaagccagaattacagcagatgaatggggt
gaaaactactttctgatgggtccctattttgaacataatgtgaagactcaagtagaagta
tgtgagcctctcaacccggctattaaaaaggcagtggaaacaatgaaaggccaagggtgt
caggtcttttttggaagatggctgatagaaggcagcccatatgttgtactgtttgatata
gcatccgcagcttggaatctggacagatggaaaggagaattctgggatgcaagcaacata
ggaatccctttccaggacagagaggccaatgatgctgtgatctttggatcattaacagcc
tggttcttaaaagagatctccagtcaaattgatgacaagcctaacataattgctcacttt
catgaatggcaagcaggggttggtataatcctcactcgatttaggaaacttcctgttgcc
acaatctttactacccatgccacactgctcgggagatacctgtgtgcagcaaacatagat
ttctacaacaatcttgaccagtttgatatagacaaagaagcaggagagagacagatttat
catcggtactgcatggaacgagcctcagtacattgtgcccatgtgttcaccacagtctct
cagataacagccacagaagcagaacatatgctgaagagaaatgctgatgttgtcacccca
aatggtttgaacattaagaaattttcagcaacacatgagtttcagaacttacacatcatg
tacaaagctaggatccaagagtttattcgtggtcatttctatggtcatcttgacttcaac
cttgaaaatactttatttttcttcattgctgggagatatgagttttccaacaaaggagct
gatatatttctagaggccttatccaggttaaacttcttgctgagggtgcacaaaagtgac
accacagttgtagtgttcttcataatgcctgcaaaaacaaataatttcaatgtggaaacg
ttaaaggggcaagcagtccgcaagcagctatgggacactgcacaatctgtgaaagaaaaa
tttggaaagaaactttacgatgcactcttaagaggagaaattccagacttgaacaagatc
cttgatcgggatgacataaccataatgaaaagagccatctttgcaactcagagacagaca
ctacctccagtgaccacccacaacatgcttgatgatagcaatgatcccattctcaatacc
attcggcgcattggactcttcaacaaccgcactgacagagtcaaggtaatattacaccca
gagttcctttcttcagcaagtccattattacctatggactatgaagagtttgtcagaggc
tgccatctgggagtgtttccatcttactatgaaccctggggttatacaccagcggaatgt
actgtgatgggcattcctagtgtgaccacaaacctttcgggatttgggtgtttcatgcgg
gagcatgtagctgacccagctgcttatgggatttatatagttgacaggaggtttcgctct
cctgatgagtcgtgcaaccagctgactcagttcctgtatggattttgccagcagtcacga
cgccagagaattatccagagaaatcgaactgaaagactctcagacctgctggactggaga
tacttaggcaggtactacatgcatgcaagacacctggctctcagcagagctttccctgaa
aaatttgagatggaaccaagtgctcctcccaagacggaaggtttcaggtaccccaggccc
tcgtcagtcccaccatccccttctgtctcccagccttccagccctcatcaaagtgatgag
gaagatgaagatgaggatgaaagatatgatgaggatgaagaggctgaaagggacaagcaa
aatataaaggcacccttttcccttggaataatgccaccaggaaagaagcagcagcatgga
gaatataggaactga

DBGET integrated database retrieval system