KEGG   Alligator sinensis (Chinese alligator): 102376249
Entry
102376249         CDS       T02922                                 

Gene name
TM7SF2
Definition
(RefSeq) LOW QUALITY PROTEIN: delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00100  Steroid biosynthesis
asn01100  Metabolic pathways
Module
asn_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102376249 (TM7SF2)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102376249 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 102376249
NCBI-ProteinID: XP_014382006
UniProt: A0A1U8DNU4
Position
Unknown
AA seq 422 aa
MDRYRVPRTKEMEFGGALGTAVLTLLLPGAMWYLLTACGTEEASVLQVPPVPAPRILANP
QALLLVLGWLGLQAALHMLPMGKVTEGIILRDKTRLQYRVNAFQVLGLTALGVGAGLAAG
LRLSFIHDHLLELAGAATLVAFGLSLLLYLKALLASEAALAPGGNSGNPIYDFFMGHELN
PRVGSFDLKYFCELRPGLIGWVSARVGRSWGGAEIWGQLSSGGWEARGRGXCVPSTPPXP
GHAWQEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYSLQAYFLVGHPQHLGLPAAVAILLL
NGLGYYIFRSANSQKNTFRRNPNDPRVAGLKTIPTATGRRLLASGWWGFVRHPNYLGDII
MALAWSLPCGLTHMLPYFYVIYFTMLLIHREARDERQCLRKYGLAWEEYCRQVPYRIFPY
LY
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggaccggtaccgggtcccgcgcaccaaggagatggagtttgggggggccctgggcacg
gcggtgctgaccctgctgctcccgggtgccatgtggtacctgctgacggcctgtgggacc
gaggaggccagtgtcctgcaggtgccccctgtacccgccccccgcatcctcgccaacccc
caagccctcctccttgtcctcggctggctcggcctccaggccgccctccacatgctgccc
atgggcaaggtcacggaggggatcatcctgcgggacaagacccggctccagtatcgtgtc
aacgccttccaggtgctggggctgacagcgttgggggtgggtgcggggctggccgcaggc
ctgcgcctcagcttcatccacgaccacctgctggagctcgctggcgctgccactctcgtg
gcctttggcctcagcctcctgctctacctcaaggccctgctggcctccgaggctgccctg
gcacctggcggcaactcggggaaccccatctatgacttcttcatgggccacgagctgaac
ccacgtgtgggctcctttgacctcaagtatttctgtgagctgcgcccaggcctcattggc
tgggtgagtgccagggttgggaggagttgggggggggcggaaatatggggccagctcagc
tccgggggttgggaggcgaggggtaggggttgatgtgtcccctccactcccccatgacct
ggccatgcctggcaggaggccgtgctgaccaccatggacatagtgcacgatggctttgga
ttcatgctggtcttcggggacctggcctgggtgcccttcacctacagcctgcaggcctac
ttcctcgtcggccacccccagcatctcggtctgcccgccgctgtcgccatcttgctgctc
aatgggctgggctactacatcttccgcagtgccaactcccagaagaacaccttccgcagg
aaccccaatgaccctcgagtcgccggtctcaagacaatccctacagccacgggccggcgc
ctactcgcatcaggctggtggggcttcgtacggcaccccaactacctgggggacatcatt
atggccttggcctggtcactgccctgcggcctgacgcatatgctgccctacttctacgtc
atctacttcacaatgctgctgatccaccgcgaggcacgggatgagcgccagtgcctgcgc
aagtatgggctggcctgggaggagtactgccggcaggtgccctaccgcatcttcccctac
ctctactga

DBGET integrated database retrieval system