KEGG   Alligator sinensis (Chinese alligator): 102376673Help
Entry
102376673         CDS       T02922                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00020  Citrate cycle (TCA cycle)
asn00640  Propanoate metabolism
asn01100  Metabolic pathways
asn01200  Carbon metabolism
Module
asn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102376673 (SUCLG1)
   00640 Propanoate metabolism
    102376673 (SUCLG1)
Enzymes [BR:asn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     102376673 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     102376673 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 102376673
NCBI-ProteinID: XP_025052932
UniProt: A0A3Q0G4A0
Position
Unknown
AA seq 195 aa AA seqDB search
MVRVKHRLTRQEKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVH
QTTQAGLGQSFCVGIGGDPFNGTNFIDCLDVFLKDPHTEGIILIGEIGGNAEEDAAAFLK
ENNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQNAGVVVSMSPAQ
LGSTMHKEFEKRKLL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggttcgggttaagcacagactgactcgtcaagaaaagactcgattagttggcccaaac
tgccctggagtcatcaatcctggagaatgtaaaattggcatcatgccaggtcacattcac
aagaaaggaagaattggtatcgtgtcaagatctggcaccctgacatacgaagctgtccat
cagacaacgcaagctggattgggacagtccttttgtgttgggattgggggagatcctttc
aatggaactaactttattgactgccttgatgtcttcctgaaggatcctcatacagagggg
attatattgattggtgagattggaggtaatgctgaagaagatgctgcagcattcttgaag
gaaaataactccggtcctaatgccaagccggtggtgtcattcatagctggcctgacagct
cctccaggcagaaggatgggtcatgctggggcaatcattgctggggggaaaggcggagct
aaagaaaagattgctgcacttcaaaatgctggcgttgttgtgagcatgtctcctgctcag
ttaggtagcactatgcacaaggagtttgagaagaggaaattgctgtaa

DBGET integrated database retrieval system