KEGG   Alligator sinensis (Chinese alligator): 102377403
Entry
102377403         CDS       T02922                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X3
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:asn01002]
    102377403
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102377403
Peptidases and inhibitors [BR:asn01002]
 Metallo peptidases
  Family M1
   102377403
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102377403
NCBI-ProteinID: XP_006019761
UniProt: A0A1U8CZP8
Position
Unknown
AA seq 952 aa
MAAAFFTLQPVDQSAVLMKTLLLLSVLSIAGSVSSDHHSGTSETDHTASGNGSKLFPWDK
MRLPKHVTPVHYDLLIHPNLTTLTFTGFANIQVTVNQQTTSIILHSKHLQITKATIQGGK
GNSHAETEVMVWKHPPFEQIALLASEPLQVGQNYTVHIEYSANLSESFHGFYKSSYRTQE
GEVRVLAITQFEPTAARMAFPCFDEPSFKAQFSVKIRREPKHLALSNMPIVRSVNISKWL
VEDHFDVSVKMSTYLVAFIVSDFKSVSKMTRHGIKISIYAVPDKINQADYALDAAVKLLD
FYEDYFSIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLYDSEKSSASSKLWITMII
AHELAHQWFGNLVTMEWWDDLWLNEGFAKFMEYVSVSVTHPELKVEDYFLGKCFDAMEVD
ALNSSHPISTPVEDPAQILEMFDDVSYEKGACILNMLWNYLTADVFKAGIVQYLRNYSYR
NTKNEDLWNSLTNICPVDGTHESQLQSDGFCTRNQQTSSSSHWTRRETLEVGTMMNTWTL
QKGFPLITVMAKGKNVYLRQEHYMKGSHSSPPTGYLWHVPLTYITSKSDTVQRFLLTTKT
DVLILPEEVEWIKFNVGMNGYYIMHYEDDGWDNLISLLKENHTAISSNDRASLINNVFQL
VSIGKLSISKALDLTLYLNHESQIMPVFQGMNELIPMYKLMEKRDMHDVENQLKEYIVNV
FKNLIDKQSWNDEGSVSERLLRNSLLLFACARKYQPCVDKAEEYFMKWKESDGTLRLPND
VKAAVYAVGAQTVEGWDFLFSKYRLPSFNTEKNKIEVALSISRNKEKLQWLMDQGLLGDI
VKTQDLPHIVVFVAKNPSGYHLAWKFLKENWNKLAQKFELGSHSIAGMVIGVTNQYSTRE
QLAQVKEFFSSLDEKSSYLRCIQQAIEIIEENIRWMDINFEQIKLWLQNNKI
NT seq 2859 nt   +upstreamnt  +downstreamnt
atggcagccgcattcttcactctgcaacctgtggatcagtcagcagtgctgatgaagaca
ctactgttgttaagtgttttgagtattgcagggtctgtgagcagcgaccaccacagtgga
actagtgagacagaccatacggcctctggtaatggaagcaaactgtttccttgggataaa
atgaggcttcccaagcatgtcaccccagtgcattatgatctactcatccaccctaatctc
accactctgacgtttactggctttgccaacatacaagttacagtaaaccaacaaaccact
tcaatcatcttgcacagcaagcacctgcagattaccaaagccaccatccaaggaggaaaa
ggaaatagtcatgcagaaacagaagtgatggtttggaaacaccccccatttgaacagatt
gcactccttgcttctgaaccactgcaagttggacaaaattatacagtccacatcgagtat
tcagccaatctatcagagagtttccatggcttttataaaagtagttacagaactcaggaa
ggagaagtgagagtacttgccataacacagtttgaaccaacagctgcacgtatggccttc
ccatgttttgatgaaccatccttcaaagcccaattttcagttaagattaggagagaacca
aagcaccttgcactatctaatatgccaatagtgagatctgtgaatatttcgaaatggctt
gttgaggaccattttgatgttagtgtaaagatgagtacttatcttgtggcctttatagtt
tcggattttaaatcagtcagtaagatgacccgtcatggaattaagatttccatctacgct
gtgcctgacaaaatcaaccaagctgattatgccttggatgcagcagtgaaacttttagac
ttctatgaagattactttagcattccataccccttacccaaacaagacctagctgctatt
cctgattttcagtctggtgctatggaaaattggggattgactacatacagggaatctgct
ttgttatatgactctgaaaaatcttcagcatcaagtaaactctggattacaatgatcata
gcccatgagctagctcaccagtggtttggaaacctagttactatggaatggtgggatgat
ctttggctaaatgaagggtttgcaaagtttatggaatatgtgtcagtcagtgttacccat
ccagaactgaaagttgaagattattttttaggcaagtgttttgatgccatggaggtggat
gcattgaattcttcacatcctatatctactcctgtggaagatccagctcaaattctagaa
atgtttgatgatgtttcctatgagaagggagcttgcattctgaacatgctgtggaattac
ctgactgcagatgtgtttaaagctggtattgtacaatatctccggaattacagctatcgg
aatacaaaaaatgaagatttgtggaatagtctgacaaatatttgtcctgtagatggcacc
catgaaagccaacttcaaagtgacggcttttgcaccagaaaccagcagacatcttcaagt
tcacactggacaagaagagagacccttgaggttgggacaatgatgaacacttggacatta
caaaagggctttccattaataactgtcatggcaaaaggaaagaatgtctatctgcggcaa
gaacattatatgaagggatctcattcttctccaccaacagggtatttgtggcatgttcca
ttaacatatattaccagtaaatctgacaccgttcaaagatttttgctgacaactaaaaca
gatgtcctcatcctccctgaagaagtggaatggataaaattcaatgtggggatgaatgga
tattacattatgcactatgaagatgatggatgggataatctgattagccttttaaaagaa
aaccacacagcaattagcagcaatgatagagcaagtctcattaacaatgtattccagctt
gtgagcattggaaaactgtcgatttccaaagctcttgatttaactttgtacttaaaccac
gaatcccaaattatgcctgtattccaaggtatgaatgagctgattcctatgtataagctc
atggagaagagggacatgcatgacgtagaaaaccagttaaaggagtacatagtcaacgta
tttaaaaacctaattgataaacagtcctggaatgatgaaggctcagtctctgaacgattg
cttcgtaattccctcctcctgtttgcttgtgcacgcaaataccaaccatgtgtggacaaa
gcagaagaatattttatgaagtggaaggaatctgatggaactttacgtttacccaatgat
gttaaggcagcagtgtatgctgttggagcacagacagttgaaggttgggacttcctcttt
agtaaatacaggctgccttcattcaacactgagaaaaacaagattgaagttgctctcagt
attagcagaaataaagaaaaacttcagtggttaatggatcaaggtttgttgggtgatata
gtaaaaacccaggatcttccacatatcgtagtgtttgttgccaagaacccatctggttat
cacctagcttggaagtttctgaaggaaaattggaataagcttgcacaaaagtttgaactt
ggctcgcactccatagcggggatggtaattggagtgacaaaccaatactctacaagagaa
cagcttgcacaggtgaaagaattcttcagttctctggatgaaaaaagttcatatctccgt
tgtatccaacaagcaatagaaataattgaagaaaatatacgatggatggatataaacttt
gagcaaatcaaactatggctacaaaacaacaaaatataa

DBGET integrated database retrieval system