KEGG   Alligator sinensis (Chinese alligator): 102377591Help
Entry
102377591         CDS       T02922                                 

Gene name
ESPL1
Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04110  Cell cycle
asn04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:asn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102377591 (ESPL1)
   04114 Oocyte meiosis
    102377591 (ESPL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:asn01002]
    102377591 (ESPL1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asn03036]
    102377591 (ESPL1)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     102377591 (ESPL1)
Peptidases [BR:asn01002]
 Cysteine Peptidases
  Family C50: separase family
   102377591 (ESPL1)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    102377591 (ESPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 102377591
NCBI-ProteinID: XP_014378635
UniProt: A0A1U8DN17
Position
Unknown
AA seq 2132 aa AA seqDB search
MPKCPGCVARFQSLLDLAELACQGYIVACPPRAPLYLEKILYHLLKSVAASGTYSACLRF
AGILRTQLGQCQRLAVPNEDFEAIAKSSFSVLWKVADALAKSDQGLGDARAVLSGRLQAT
CFLALLEEAESPLLPQEPPFFTSQTARQAAAAALMFEAQRAPLSPEDARYLSKQLACHPL
AVLLEARGGMEPWPLQSSLCLLELMLERCRRLCRGSCFQEAEDALKQARVHLSVSRGAKE
GFGAALDLLRIGIELSRVLAVGQGQTGPLLSQAAMALDAASEAQDPFLRALVESCQFMVS
SLSGYVRRSEHRPFGVEDALGASAFVKGYSQLLWRLLESMPPDSPKQQQTVKQLQSHCLQ
LYAGLAYDAFQGSQAAGLEKLAGPCRDVITWMLQLFEGLPEPEQAEYLDVTASCVFKLAY
GFYSQKLYAEACSVVELFCQRLAMEPCPYPEMPTERSDKCFKLQVESYRKLGQFEKGLEV
VALWLGALRGRVTEQMVEPVSLWVRVKMDASKKGDEDLRLKTLKDALEGHSLAPESLVAL
LSEELRAYKMVRADTGHERFNVICDLLELYPEESGQVQERAGVLLELAQVLCYHDYTEKT
ECSALDAIQEALHLLDSVPESPESQDQLLDDRAQALLWLYICSLESKMQQSIEKEQRAWT
QGQKNLEDFEPNDLNYEDKLQDDKFLYNSITFNLAAEAAQSKSLDDALALWKKLLAKKGI
PQVRSVEQTTASLHLAAALYRMMAKPLQAMECYLLLWTLCRALGDQLGTASALCQVTKLL
FHLECPSDAKLFLEEAESCLENADSSSESSLLLMQTCAVLRSQLCCMEHKIEEGLALLLK
VLQSPTLQRIAKVWYLLRAHILQLVAVYLGLPSTSLSAELRQQIWAEGWKTPETALADAH
KLLRSIILLLLGSDVLSSPKAGADASFVDYGENLLQKWQVLADMLACSEKLIALLGTVEM
VCEAKAFCVEALKLSMKLQALRWCAGFLVQKSELELQRSDVELCQSDLQQALFLLESGTA
FETEEKHKDKVKIQLTKGRCRSRQHRSPSTESAAEDEAFLKGPDLEFVATVGAEEKQATL
TTSPELKPKQKQRPRFLTHSPACACPLCSDVALVVVGLRWLVAFAHGELALGNAAEGLGL
LQTALERCAPATTRFSGVVRAVSWGKKAVLGAQPTSGLLDDVMGRIYAALAAHNLRGPQP
QKQLWELVEAGLAFLSSRPPHLPGLECHAASLLLTKAVATIYTLASAHDGCTANVFSSTW
AWKPSAPPAGTKGTAAAKAPKAKEPQPPKSRSKKQPVAITGMKPRAKRGLGAKALPPIDL
DVFTLGDSDTDVPRIVLKPVLEPATPIQKSCPPPMARSQGPKRAPQPQAPFAVFNEASPT
GVKAQLAKAPKASRRVKSRLKVTFSDDSDLDDPPAALEREDKGPAPRRVRSVASNKVTQP
SGSSKKATAERKGSQASSLDNVSQGSTARLQRGGAGVKKALRGRTALRAPSREQEEDKEL
LRAITEEETLEEELELSFEVLRGSDEEDPAPGTKKGVTWAPGEREVLRRDASASPWESFP
AAGRKGSGDVLSLQPPSAMLAAIGLPSLDSVCESLMAALTSISHCPPSALYCQLCRLLAL
CTGSRDPLATACLVSESVAIGARHQMLSSIHRRMHKAKKSGDVAEQLEELSMHGVPADPR
MQRLAQLQHLFQFSSAGLGQLEMEAFREQLWQIPSGVTVCILALGSVQPSTVGDTLLLTR
LERDGAPVTIRIPTAGSKVPLSSVLEEFDAIQAQQKEFNNCTDKRDWWLGRSELDHRMKS
LTETLEKQVLGCWKGALLPAGPDPVATKAVLELHKRLRECGWEDPDPALLKVVLNGAHLL
APPDVQRLALGLCPAKPAAAQALLQAAVEEERGACGKQAGSSLLLVLDKHLQKLPWENMP
CLQALPVTRLPSLRFLLSYSLGSQDQMGSVLTRGVDRSSAFYVLNPHGNLPGTEERFRAW
FESEAGWSGVTGTVPSREQMQAALMEHDLYIYAGHGAGARFLDGHSILKLDCAAVTLLFG
CSSVALAVRGSLEGSGIVLKYIMAGCPLVLGNLWDVTDRDIDRYTEALLQSWLRAGPGAP
LLDHVIQARQAPRLKYLIGAAPVAYGLPVSLR
NT seq 6399 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatgcccgggctgcgtggcgcgcttccaaagcctcctggacttagcggagctg
gcgtgccagggctacatcgtggcttgccccccgcgtgctcccctctatcttgagaagatc
ctctaccacctgctgaagagcgtggctgcctcgggcacctacagtgcctgcctgaggttc
gcagggatccttcgcacccagcttgggcagtgccagcgtctggcagtacccaatgaagac
tttgaggccattgccaagagcagctttagcgtgctgtggaaggtggcagacgcccttgcc
aagtctgaccagggtcttggggatgccagggcggtgctctcagggcgtctgcaggccacg
tgtttcctggcactcttggaagaggccgagtcccccttgctgccccaggagccgcccttc
ttcacctcccagacggcacgccaggctgcggcggccgctctaatgtttgaggctcagagg
gccccgctgagcccagaggatgcccgctacctcagcaagcagcttgcttgccacccactc
gcagtcctgctggaggccaggggtgggatggagccctggcccctccagtcctccctgtgc
ctgttggagctcatgctggagcgctgccgtcgcctctgcaggggcagctgcttccaagaa
gccgaggatgccctgaagcaagctcgggtccacttgagtgtatccaggggtgccaaggag
ggatttggtgctgcactggacctgctgcgtattggaatagagctgagccgggtgctggca
gtgggtcagggccagacagggccccttctgtcccaggctgccatggctctggatgctgcc
tctgaagcccaggacccctttctccgggcactagtggaaagttgccagttcatggtctcc
tccctcagcggatacgtgaggaggagcgagcataggccctttggggtggaagatgccctg
ggcgcctcagcctttgtgaagggctattctcagctcctgtggcggttgctggagagtatg
cctcctgacagcccgaagcagcagcagactgtgaaacaactgcagtcccactgcctccag
ctctatgccggcctggcatacgatgccttccagggctcccaggcagctggcctggagaag
ctggcggggccatgccgagacgtcatcacgtggatgctacagctgttcgaggggctccct
gagccggagcaggcagagtacctcgatgtgacggcatcatgtgtgttcaagttggcctat
ggcttctacagccagaagctgtatgcagaggcctgctctgttgttgagctcttttgccag
aggctggcgatggagccctgcccctatccagagatgcccacggagaggtctgataagtgc
ttcaagctgcaggtggagagctaccggaagctgggccagttcgagaagggccttgaggtg
gtggcactgtggctgggggcactgcgtggccgggtcacagagcaaatggtagagccagtg
tctctctgggtccgagtcaagatggatgcaagcaagaagggggacgaagacctgagactg
aagactctgaaggatgccttggaggggcacagcttggccccggagtctctggtggccctg
ctctccgaggagctgcgggcctacaagatggtgcgggccgacacggggcatgagcgtttc
aatgtcatctgtgacctgctggagctatacccagaggagagtgggcaggtgcaggagcgt
gcgggggtcctgctagagctggcccaggtgctgtgctaccacgactacacggagaagact
gagtgctctgccctggatgccattcaagaggccctgcatctgctagactccgtgcctgag
agcccagagagccaggaccagctgctggatgaccgagcccaagccttgctctggctgtac
atctgcagcctggagtccaagatgcagcagagcattgagaaggagcagagagcctggacc
cagggccaaaagaacctggaggactttgaacccaatgacctcaactatgaagacaagctc
caggacgacaagttcctgtataacagcatcaccttcaacctggcggccgaggctgcccag
tcaaagagcctggatgatgcccttgccctctggaagaagctcctagccaagaagggcatc
cctcaagtgcgcagcgtggagcaaaccacagcctccctgcaccttgcagctgctctctac
aggatgatggctaagcccctgcaagccatggagtgttatctgctgctctggaccctctgc
agagccctcggggaccagctggggaccgccagtgctttatgccaagtgaccaagctcctc
ttccacctcgagtgtcccagtgatgccaagctcttcctggaagaagcggagtcctgcttg
gaaaacgccgacagcagcagcgagtccagcctgttgctgatgcagacatgtgccgtgctg
cgcagccagctctgctgcatggagcacaagatcgaagagggccttgctctgttgctcaag
gtgctccagagccccaccctgcagaggattgccaaggtctggtacctgctccgagcccac
atcctccagctggtggcagtctacctgggcctcccttccaccagcctctcggcagagctc
cgacaacagatctgggctgaagggtggaagacccccgagacggctcttgctgatgcccat
aagctcttacggagcatcattctccttctgctgggcagtgatgtgctgtcctcccccaag
gcgggtgcagatgcctcatttgtggattatggggagaacctgctgcagaagtggcaggtg
ctggcagacatgctggcctgctcagagaagctgatcgcccttctgggcacggtggagatg
gtgtgcgaggccaaggccttctgtgtggaagctctcaagctctccatgaaactccaggct
ctccggtggtgcgctggcttcctggtccagaagagcgaactggagctgcagcgcagcgat
gtggagctctgccagtcggacctgcaacaggccctgttcctgctagaatccggcacagcc
tttgagacggaggagaagcacaaagacaaggttaagatccagctgacaaaagggagatgc
cggagcaggcagcaccgcagccctagcacagagtctgcagcagaggatgaagccttcctg
aaggggcccgacttggagtttgtggccacggtgggagcagaggagaagcaagctaccctc
accacgtccccagaactgaagcccaagcagaaacagcgcccgcgcttcctgacccattca
cctgcctgcgcctgccccctctgttctgatgtggccctcgtggttgttggcctccgctgg
cttgtcgccttcgcccacggcgagctggcactggggaacgcggcagaaggccttggcctg
ctgcagactgcactagagcgctgcgccccagcgaccacgcgcttctctggtgtcgtacgg
gctgtgtcctggggcaaaaaagctgtgctgggggcccagcccacctcggggctcctggat
gacgtgatgggccgtatctatgctgctttggctgctcacaacctgaggggcccccagccg
cagaagcagctgtgggagctggtggaggctggcttggctttcctgtcctcccggccgcca
cacctacctggccttgagtgccatgctgcgagcctgctgctcacaaaagctgtggccacc
atctacaccctggcctctgcacatgatggctgcacagccaacgtcttctccagcacctgg
gcctggaagccctcggcaccacctgctgggaccaagggaactgcagcagccaaagccccc
aaggccaaggagccccagccccccaagagcaggagtaagaagcagccagtggctattact
ggcatgaaacctagagcaaagcggggccttggagccaaggccctgcccccgatagacttg
gatgtcttcaccctgggggactcggacactgatgtacctcgcatcgtgctcaaacctgtg
ctggagccagccaccccaatccagaagtcctgcccaccccccatggcccgctcacagggc
cccaagcgagccccccaaccccaggctccttttgctgtgtttaatgaggcctcccccaca
ggggtcaaggcccaactggccaaggctcctaaggcctccaggagagtcaagtcacgcctg
aaggtaaccttcagtgatgacagtgacctggatgatcctccagcagctctggaacgagag
gacaaagggccggcacccaggagggtgcgttcagtggccagcaacaaggtgacacagccc
tctggcagcagcaagaaggccacggcagagaggaagggatcccaggccagctccttggat
aatgtctcccagggaagcacggccagactgcagcgaggcggagcaggcgtgaagaaggct
ctgaggggcagaactgcgctgagagcccccagcagggagcaggaggaagacaaggagctc
ctgagggccatcacagaggaggaaacactggaagaggagctggagctcagcttcgaggtg
ctgcggggctcggacgaagaggacccagctccaggcacaaagaagggtgtgacttgggca
ccaggtgagcgcgaggtgctgcggagagatgccagtgccagcccatgggagtccttccca
gctgctggcaggaaaggaagcggggatgtcctcagcttgcaacctccctctgccatgtta
gctgccataggacttccttccctggactcagtgtgtgaatctctgatggctgccctcact
tccatcagccactgccccccaagtgccctgtactgccagctctgccgcctcctggcactg
tgcacgggcagccgggacccacttgccactgcctgcttggtctcggagtcggtcgccatc
ggtgcccgccaccagatgctgagcagtattcacaggagaatgcacaaagccaagaagtca
ggagatgtggcagagcagctggaggagctcagtatgcatggggtgcctgctgatccccgg
atgcagcgccttgcccagctccagcacctcttccagttcagctcagctgggctaggacag
ctggagatggaggccttccgggagcagctgtggcaaatccctagtggtgtgactgtgtgc
atcctggccctggggagcgtccagcccagcaccgtgggggacacgctgctgttgacgcgg
ttggagagggatggcgcccctgtgactatccggataccgactgcgggcagcaaggtgccc
ctgagctcggtgctggaggagtttgatgctatccaggcccagcagaaggaattcaacaac
tgcacggacaagcgggactggtggctgggccgctcagagctggaccacaggatgaagagc
ctgacagagaccctggagaagcaggtgctgggctgctggaagggggccctgctgccagct
ggcccagatccagttgctaccaaggcagtattggagttacacaagcgcctccgtgagtgt
ggttgggaggacccagacccagctctgctcaaggtagtactgaatggtgcccacctcctg
gccccccctgatgtgcagcgcctggcactggggctgtgcccagccaagccagctgctgcc
caggccctgctacaggcagcggtggaggaggagcggggggcctgtggcaagcaagctggc
agctccctgctgctcgtgctggataagcatctgcagaagctgccctgggagaacatgccc
tgcctgcaggccctgcccgtcacccgcttgccctccctgcgtttcctactcagctactcg
cttggcagccaggaccagatgggctcagtgctgacccgtggggtggatcgcagcagcgcc
ttctatgtcctcaacccccatggcaacctacctgggacagaagagcgcttccgcgcatgg
tttgagagtgaggctggctggtcgggggtgacgggcactgttccaagccgagagcagatg
caggcggcgctcatggagcatgatctgtacatctatgctgggcatggggcaggtgcccgc
ttcctggatggccactcgatcctgaagctggactgtgcggccgtgaccctgctctttgga
tgcagcagtgtcgccctggctgtacgtggcagcctcgaagggtctggcatcgtcctcaag
tacatcatggccgggtgtcccctggtcctgggcaacctctgggacgtcaccgaccgcgac
attgaccgctacacagaggcgctgctccagagctggctgcgggcagggccaggtgccccc
ctcctggaccacgtcatccaggcccgccaagccccacgcctcaagtacctcatcggtgct
gcccccgtggcctacggcctccctgtgtctctgcgctga

DBGET integrated database retrieval system