KEGG   Alligator sinensis (Chinese alligator): 102377714Help
Entry
102377714         CDS       T02922                                 

Definition
(RefSeq) cytosolic phospholipase A2 beta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00564  Glycerophospholipid metabolism
asn00565  Ether lipid metabolism
asn00590  Arachidonic acid metabolism
asn00591  Linoleic acid metabolism
asn00592  alpha-Linolenic acid metabolism
asn01100  Metabolic pathways
asn04010  MAPK signaling pathway
asn04217  Necroptosis
asn04270  Vascular smooth muscle contraction
asn04370  VEGF signaling pathway
asn04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102377714
   00565 Ether lipid metabolism
    102377714
   00590 Arachidonic acid metabolism
    102377714
   00591 Linoleic acid metabolism
    102377714
   00592 alpha-Linolenic acid metabolism
    102377714
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102377714
   04370 VEGF signaling pathway
    102377714
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102377714
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102377714
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102377714
Enzymes [BR:asn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102377714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 102377714
NCBI-ProteinID: XP_014383054
UniProt: A0A1U8DZC2
Position
Unknown
AA seq 815 aa AA seqDB search
MGDSSYKKTSSSNCLFSVRVIQARNITSRDLATASDCYVSLWLPTASNGKFQTQTIENSD
DPVWNETFYFRIQTEVKNILELTVFDKDPVTKDDIQFTVLFDVANVRPGVVAHETFSLKS
EKQKSFQQWESLEVEFKMEKIPGPPENLRTNGVLVSREMCCLEVQVEKEENKKYLKENKN
VVLTVHASYEGTQKTTIDVDTFHFHCIKGWEPILKARLQKISDKEEKEDNSHNSLTVPLK
LLPVGQKVTVGMLLEDKTELKLHLQVNDCSENLDVRLGYDLCADEQEFLHKRKKVVASAL
KKVLQLKEDLHEHEVPVIAVMTSGGGLRAMTSMYGHLLSLQKLNLLDCTTYITGTSGSTW
TMTDLYGNSNWSEKTLEGPLKEIKKQVTKCKLNIISIQRLNYYHTELIERVKEGLFSSFT
ALWALIQEMFLHDEPNKHKLTDERQAVDQGQNPLPFYVALNVKDEVSTFKFREWVEFSPY
EVGFPKYGAFIRSENFDSEFYMGRLVKKFPESRICYLEGLWTNVFTRNLLDGLFWSSNPE
EFWDRWAKDMIDMDKENSSDIYSTVIKPPSTLSGKLCEIFEDIMTKRPLLGETHNFLKGL
EFHKGYFQQKKFTEWKDTVLDASPNQLTPLEKHLCLIDVGYFVNTSCPPLLRPERNVDVI
ISLDYSLGGFFKQLQKIEKYCKVQKIPFPKIEVSEEDQKNPKECYIFSDAENPRAPILIH
FPLVNDTFKEYKEPGVKRNFCEMQEGKVNLDNCKSPYYLTKLQYSSENFDKLVNLSSYNI
LNNKDLILQYIQSATEKKRKSRRGGLPSTSRAEYV
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgggggactcatcgtataagaaaacaagctcttccaactgcctgttttctgtaagagtc
atacaggccaggaacattacatcaagggacctagcgactgcatctgattgctacgtgagc
ctgtggctgccaacagcttcaaatggaaagttccagacccaaaccatcgagaactctgat
gaccctgtctggaatgagactttttacttcaggatccagactgaagtcaagaatatctta
gaactgactgtctttgataaggacccagtcaccaaagacgacatccagttcactgttctc
tttgatgttgctaacgtgaggcctggagtggtagcccatgaaacattctctttgaaatcg
gagaaacagaaatcttttcagcaatgggagtctttggaagtagaatttaagatggaaaaa
attcctggacctcctgaaaacctcaggacaaatggtgtccttgtgtctcgtgaaatgtgt
tgcttggaagttcaggtggagaaggaggagaataaaaagtatttgaaagagaataaaaat
gtagtgcttacagtgcatgcgtcatatgagggaacacagaaaaccaccatagatgtagat
actttccacttccactgcataaagggttgggagcccatactaaaagccagactccagaaa
atttcggataaggaagaaaaggaagacaattcacataactcgttaacagtcccactgaag
ttacttcctgttggacagaaagtgacagttggcatgctcttagaagataagacagagctg
aagttgcatctgcaagtaaatgactgctcagaaaatctagatgtgcggttagggtatgat
ctttgtgctgatgagcaagagttcctgcacaaaagaaagaaggtggttgctagtgccctg
aaaaaggttctccagctgaaggaagatctacatgagcatgaggttccagtgattgctgtt
atgacgtcaggtggaggcctcagagcgatgacttccatgtatggccaccttttatctctc
cagaagctgaatcttttggactgtacaacttatatcactgggacatctggctccacatgg
accatgacagatctgtatggaaatagcaactggtcagagaaaactctggaagggccatta
aaagaaataaagaaacaagtgacaaaatgcaagctaaatattatatccatacagcgcctg
aattattatcacacggagttaattgaaagggtaaaagaggggctcttctcttcttttaca
gcactgtgggcacttattcaggaaatgtttttacatgatgagccaaataagcataaactc
acagatgagcgtcaggctgtggatcagggtcagaaccccctgcctttctatgtagccctc
aatgttaaagatgaagtcagcacttttaagtttagagaatgggtggagttctcaccttat
gaggtgggattcccaaaatatggagctttcattcgctcagaaaattttgacagtgagttc
tacatggggaggctggtgaagaagttcccagagtcccggatctgctatttggaaggtctc
tggactaatgtctttactcggaatttgttggatggcttattctggtcttcaaatccagaa
gaattttgggatcgatgggccaaagacatgatagatatggataaagaaaatagttctgac
atctactccactgtcatcaagcctccgtcaactttgtcagggaaactctgtgaaatcttt
gaggacattatgaccaagcgcccactactgggagagactcataatttcctgaaaggcctg
gaatttcacaagggctatttccaacagaaaaagtttactgaatggaaagacactgtgcta
gatgcatctcccaaccaactgacaccactggagaaacacctctgtttaatagacgttgga
tattttgttaataccagttgcccaccgcttttgaggcctgagagaaatgtggacgtcatt
atatcacttgattacagtttgggcgggttcttcaagcaattacagaagatagaaaaatat
tgcaaagtccaaaaaatcccgttccccaaaattgaggtgagtgaggaagatcagaagaac
ccgaaggagtgttacatattttcagatgcagagaaccccagagctcccatactgatccat
ttccctctggtgaatgacacgtttaaggaatacaaggaaccaggggtgaagcgcaatttc
tgtgaaatgcaagagggcaaggtaaatttggacaactgcaagtcaccatactatcttaca
aaattacagtattcttctgaaaattttgacaaactcgtgaatctgagcagctacaatatc
ctcaataacaaagacctgattctgcagtatatccagagtgccacggaaaagaagagaaag
agcaggagaggaggtctacccagcacttctagggctgaatatgtgtag

DBGET integrated database retrieval system