KEGG   Alligator sinensis (Chinese alligator): 102378195Help
Entry
102378195         CDS       T02922                                 

Gene name
ACOX1
Definition
(RefSeq) LOW QUALITY PROTEIN: peroxisomal acyl-coenzyme A oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00071  Fatty acid degradation
asn00410  beta-Alanine metabolism
asn00592  alpha-Linolenic acid metabolism
asn00640  Propanoate metabolism
asn01040  Biosynthesis of unsaturated fatty acids
asn01100  Metabolic pathways
asn01200  Carbon metabolism
asn01212  Fatty acid metabolism
asn03320  PPAR signaling pathway
asn04146  Peroxisome
Module
asn_M00087  beta-Oxidation
asn_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    102378195 (ACOX1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102378195 (ACOX1)
   00592 alpha-Linolenic acid metabolism
    102378195 (ACOX1)
   01040 Biosynthesis of unsaturated fatty acids
    102378195 (ACOX1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102378195 (ACOX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102378195 (ACOX1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102378195 (ACOX1)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     102378195 (ACOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 102378195
NCBI-ProteinID: XP_014372736
UniProt: A0A1U8CXH8
Position
Unknown
AA seq 647 aa AA seqDB search
MGSPCFSPLTPPAEALVLNDPEFQHEDLNFLSRSQRYEVAIRNXXXXXXXXXXALMVMKL
REYGIADPDEIYWFKRICLGSFTGPLTLHFGMFTHTVENQGTVDQQEKWLPLASGLQIIG
TYAQTEMGHGTHLRGLETTATYDPATQEFILNSPTVTSIKWWPGGLGKTSNHAIVLAQLY
TQGQCKGLHAFIVPIRQLGTHEPLPGITVGDIGPKFGYDEMDNGYLKMDNFRIPRENMLM
KYAKVEPDGTYVKPLNDKLTYGTMVFIRSIIVGDSARSLSRACTIAIRYSAVRHQSELKP
GEPEPQILDYQTQQYKLFPLLATAYAFHFVGAYMKETYLRITGDISEGDLSQLPELHALT
AGLKAFTSWIANAGIEECRMACGGHGYSRCSGLPDIYVTFTPSCTYEGENTVMMLQTARF
LVKCYAQVSSGQLVSGMVSYLNDLSGQRIQPQQVAARPTTVHINDPASLVEAYKVRASRL
VEAAAKNLQGELNHRESKEDAWNRTSVDLVRASEAHCHYVVVKLFTAKLSEISDAAVRAV
MTNLCLLYALHGISKHTGDFLQAGILTDAQVTQVYQHVKDLLAIIRPNAVALVDSFDFHD
SHLGSVLGRYDGNIYENMFEWAKKSPLNKTEVHESFHKHLKPMQAKL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggggtccccctgcttctctcccctcaccccccctgcagaggcgctggtcctgaatgac
cctgaattccagcacgaggacctgaacttcctgtcgcgcagccagcgctatgaggtggcc
atccggaacannnnnnnnnnnnnnnnnnnnnnnnnnnnngccctcatggtgatgaagctg
cgcgagtacggcatcgccgaccccgatgagatctactggttcaaaagaatatgcctgggc
tcttttactgggcctttaactctccacttcggcatgtttacacacaccgtagagaaccag
ggcactgttgaccaacaagagaaatggctgcctctcgcctctggactgcagataattggc
acctacgcccagactgaaatgggtcatggaactcatctccgaggcctggagaccactgcc
acctatgacccagctacccaggaattcattctcaacagccccactgtgacttccattaag
tggtggcctggtggactcggaaagacctcaaaccacgccatagtcctggctcagctctac
actcaggggcaatgcaaagggttgcatgccttcattgtacccattcggcaattgggcacc
catgaacccttgccaggtattactgtgggtgacatcggaccaaagtttggttatgatgaa
atggataatggctacttaaaaatggataacttccgtatcccccgggaaaacatgctcatg
aagtatgccaaggttgaaccagatggtacgtatgtgaaacccctcaatgacaagctgact
tatgggacaatggtattcatccgatccatcatcgtgggtgactctgctcgctccctgtcc
agggcttgcaccattgctattcgctacagtgcagtaaggcaccagtctgagctgaagcca
ggggagccagagccccagatcttggattatcagactcaacaatacaaactctttcctctc
ctggcaactgcatatgcctttcattttgttggagcttacatgaaagaaacttatcttcgc
attacaggagacatcagtgagggagacctgagccagctgccagagctccatgcactgact
gcagggctgaaggcattcacttcatggatagccaatgctggcattgaggaatgtcgaatg
gcatgtggtgggcatggctactctcgttgcagcggccttcctgatatctatgtcactttc
actccatcctgtacctacgaaggagaaaacactgtcatgatgctgcagacagctaggttc
ctggttaaatgttatgctcaggttagttcgggccagttggttagtggaatggtatcctac
cttaatgacctctcagggcaacgcatccaaccacagcaagtggctgcaagacccacaacc
gtgcacatcaatgatccagccagcctggtagaagcatataaagtacgggcatccaggctt
gtagaagctgcagcaaagaacttgcaaggggagctgaaccatagggagagcaaggaagat
gcctggaaccgaacctctgttgatctggtgcgagcttcagaggcacactgtcactatgtg
gtggtgaagctcttcacagcgaagctctcggagataagtgatgcagctgttcgtgctgtc
atgaccaatctgtgtctcctgtatgctcttcatggaatcagtaagcacacgggggacttc
ctgcaggcgggcattttgacagatgcacaggttactcaggtataccagcatgtgaaggat
ctcctggctataatccgccccaatgctgtagcactagtcgattcctttgactttcatgat
tcccatcttggatctgtgcttggacgctacgatggcaacatctatgagaacatgtttgag
tgggcaaagaaatcccccctaaacaaaactgaggttcatgagtctttccacaaacacttg
aagccgatgcaagccaagctgtga

DBGET integrated database retrieval system