KEGG   Alligator sinensis (Chinese alligator): 102378519Help
Entry
102378519         CDS       T02922                                 

Gene name
ACVR1
Definition
(RefSeq) activin receptor type-1 isoform X1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04060  Cytokine-cytokine receptor interaction
asn04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102378519 (ACVR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102378519 (ACVR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:asn01001]
    102378519 (ACVR1)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102378519 (ACVR1)
Protein kinases [BR:asn01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   102378519 (ACVR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS APH Haspin_kinase FTA2 TMEM154 PSI_PsaJ
Motif
Other DBs
NCBI-GeneID: 102378519
NCBI-ProteinID: XP_025055716
UniProt: A0A3Q0G7S0
Position
Unknown
AA seq 553 aa AA seqDB search
MTCVYMKLCIEVEVSSFSRSIMIHGVMILPVLMMMAFPSPSFEDDELKLNMVPYECVCEG
MSCGAEDRCRGQQCFSSLSINDGSKVYQKGCFQVYEQGKMTCKTPPSSDQAVECCQGYLC
NMNITAQLPTKGQTLQGEAVGYTVETLILVILAPVLVLIIFSVVAVLIIRKIQKHHMERL
NSRDAEYGTIEGLIASNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLVECVGKG
RYGEVWRGQWQGENVAVKIFSSRDEKSWFRETELYNTVLLRHENILGFIASDMTSRNSST
QLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAISHRDL
KSKNILVKKNGQCCIADLATLELTQLFFAQLHLVDCLFSGLAVMHSQSTNQLDVGNNPRV
GTKRYMAPEVLDETIQADCFDSYKRVDIWAFGLVLWEVARRMLSNGIVEDYKPPFYDLVP
NDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLT
KIDNSLDKLKADC
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgacctgtgtttatatgaagttatgcattgaagtggaagtaagttctttttcaagatct
ataatgatacatggagttatgattcttcctgtactgatgatgatggcttttccctcaccc
agtttcgaagatgatgagctgaagctaaacatggtcccctacgaatgtgtgtgtgaaggc
atgtcctgtggggctgaagatcgctgccggggccagcagtgcttttcctccctcagcata
aatgatggctctaaagtataccagaaaggctgtttccaagtctacgaacaagggaaaatg
acatgcaagacacccccatcttctgaccaagctgttgagtgctgtcagggatacttgtgt
aacatgaatatcacagcacagttgcctactaaagggcaaactcttcagggagaagctgtg
ggttacactgtggaaacactaatccttgttatactggctccagtactagtgctgataatc
ttttctgtggtagctgtgttgatcatcagaaaaatccagaaacaccatatggaaaggctc
aattccagagatgcagagtatggcacaattgaaggactcattgcatcaaatgttggagac
agtacattggcagacttactggaccattcctgtacatctggcagtggctctggtcttcct
ttcctggtgcaaagaacagtggctcgtcagattacacttgtagaatgtgtaggaaaaggc
cgatatggagaggtctggagagggcagtggcaaggagaaaatgttgcagtgaagatcttt
tcttcccgagatgaaaaatcctggttccgggaaactgaactgtacaacactgtattactg
cggcatgaaaatattttaggttttattgcttcagatatgacctccagaaactccagcacc
cagttgtggttaattacacactatcacgaaatggggtctttgtacgactatctacagctt
acaacgcttgatactgtcagctgcctacgaatagttctgtccatagccagtggtcttgca
catttgcacatagagatatttgggacacaagggaagcctgctatttcccatcgggacttg
aagagcaaaaacatccttgttaagaaaaatggacaatgctgcatagcagatttagcaact
ttggagctgacacagctattctttgcacagctgcacctagttgattgcttgttttcaggt
cttgcagttatgcactcccaaagcactaatcagttggatgtggggaacaaccctcgtgtg
ggtaccaagcgttatatggctccagaagtgttggacgaaaccatccaagcagactgtttt
gattcttataaaagggttgacatctgggctttcggactggttctctgggaagttgccaga
cgtatgcttagcaatggtattgtagaagactataaaccaccattctatgatttggttcct
aatgacccaagttttgaagatatgagaaaagtggtctgcgtagatcagcaaaggccaaac
attcccaacagatggttctcagacccaacattaacatctcttgccaaactgatgaaagaa
tgctggtatcaaaacccatcagcaagactaacagccctgcgaatcaaaaagactttgacc
aaaattgataattccttagataagctgaaagctgactgttga

DBGET integrated database retrieval system