KEGG   Alligator sinensis (Chinese alligator): 102378538Help
Entry
102378538         CDS       T02922                                 

Definition
(RefSeq) 5-phosphohydroxy-L-lysine phospho-lyase
  KO
K18202  5-phosphonooxy-L-lysine phospho-lyase [EC:4.2.3.134]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00310  Lysine degradation
asn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102378538
Enzymes [BR:asn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.134  5-phosphonooxy-L-lysine phospho-lyase
     102378538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 IF-2B
Motif
Other DBs
NCBI-GeneID: 102378538
NCBI-ProteinID: XP_006026911
UniProt: A0A1U7S037
Position
Unknown
AA seq 409 aa AA seqDB search
MYDENGRQYLDCINNVAHVGHCHPDVVNAANEQNQLLNTNSRYLHDNIVDYARRLSKTLP
EKLCTFYFLNSGSEANDLALRLARQHTKHTDVIVLDHAYHGHLTSLIDISPYKFRNLEGQ
KDWVHVAPIPDTYRGIYREDHKDLVTAYANEVKEIIEQAHKKGRKIAAFFVESLPSVAGQ
IIPPAGYFQKVAEHVHKAGGVFVADEIQVGFGRVGKHFWAFQLQGEDLVPDIITMGKPIG
NGHPVACVATTKEIAESFAATGVEYFNTFGGNPVSCAIGLAVLDVIEKEHLQAHAMQVGN
FLMELLNQQKVKHPIIGNVRGAGLFIGVDLIKDQEKRTPATEEAEYLITRLKKEYILLST
DGPGRNVLKFKPPMCFSVQDAKLVVDAMDKILTDMEKEAACEPVGDLES
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgaaaatggaagacagtaccttgactgtattaacaatgtggctcatgttgga
cactgccaccctgatgtagtaaatgcagccaatgaacagaatcagttgctaaatacaaat
tctcgttatctccatgacaatatagtggattatgcaagaagactttccaaaacactgcct
gagaagttgtgcaccttctattttttgaattcaggatcagaagccaatgaccttgccctg
cgattggcacgacaacatacaaaacacacagatgttattgtgttagatcatgcttaccat
ggacatctgacatccttgattgacattagtccatataagttcagaaatctagaaggacag
aaggattgggtccatgtggctcctatcccggacacgtaccgtggaatatacagagaagat
cataaagatttagttacggcttatgccaatgaagtgaaagaaatcattgagcaagcacac
aaaaagggtagaaagattgcagcattttttgttgaatctctaccaagtgttgccggtcag
atcattccaccagcaggctatttccaaaaggtagcagaacacgtgcacaaagcaggaggt
gtatttgttgctgatgaaattcaagtaggttttggcagagttggcaaacacttttgggca
ttccagcttcagggagaggatttggtaccagatatcatcactatgggcaaaccaatagga
aatgggcaccctgttgcctgtgtagcaacaacaaaagaaattgcagaatcatttgcagct
actggagtggaatactttaatacatttggaggaaatcctgtttcatgtgccataggctta
gcagttttggatgtgattgagaaggagcatcttcaagcccatgccatgcaagtgggcaac
ttcttgatggaattactgaatcaacagaaagttaaacatcctatcattggcaatgtcagg
ggtgctggattatttattggagtggatttaataaaagaccaagagaaaaggaccccagct
actgaagaagcagagtacttgataacaagactgaagaaagagtacattctgctgagtact
gatggtccaggaagaaacgtacttaagttcaagcctccaatgtgctttagtgtacaggat
gccaaattagttgtggatgcaatggataaaatattaacagatatggaaaaagaggcggca
tgtgaaccagtaggagaccttgaatcttaa

DBGET integrated database retrieval system