KEGG   Alligator sinensis (Chinese alligator): 102378789Help
Entry
102378789         CDS       T02922                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-3-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00232  Caffeine metabolism
asn00983  Drug metabolism - other enzymes
asn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    102378789
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102378789
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     102378789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2 Peptidase_C71
Motif
Other DBs
NCBI-GeneID: 102378789
NCBI-ProteinID: XP_006027502
UniProt: A0A1U7S8N8
Position
Unknown
AA seq 296 aa AA seqDB search
MNIQEYFTRISYKGPSENLDLETLTAILQHHIRAVPFENLSIHCRETIALELEPVYNKIV
RRNRGGWCLESNQLLFWVLKTLGFNVTLLGGKVYDPDDKTYADHPNHLLLKVALADKSYI
LDGGFGADYQMWEPMELISGKEQSQTPGTFRFLEEKGTWHLEKRKRQAYFSSHGHSKVHL
LQTNDYRKIYIFTLEPREIEDFRALNVECQTSPDFVLVRKSICSLQTTSGMRSLIGWRYT
EIKYNYRENMDLIEATILPDEEVEKTLKDKFNITLDKKLQPVNKGKSSVFHHLARL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccaggaatatttcaccagaatttcttacaaaggccccagtgaaaacctggac
ttggagacattaactgcaatcctccagcaccacatccgggctgttccctttgagaacctc
agcatccactgcagggagaccattgcgctggagttggaaccagtgtataacaaaatagtg
aggaggaatcgtggtggctggtgcttggaaagtaaccagctgttgttctgggttctgaaa
acactgggatttaatgtcactcttctgggaggaaaagtgtacgacccagatgataagaca
tatgctgatcatcccaatcaccttctgttaaaagtggcccttgctgacaaatcttacatt
ctggatggtgggtttggggcggactatcaaatgtgggagcccatggagctgatttctggg
aaagagcagtctcagactcctggcacctttcgctttctggaagagaaggggacctggcac
ctggagaagagaaaaaggcaggcatacttttccagccatggccactctaaggttcatcta
ctgcaaacaaatgactacaggaagatttacatctttacccttgagccacgagagatagaa
gatttcagggccttgaatgtggagtgccagacatctccagattttgttttggtacggaag
tccatctgcagcctccagaccaccagtgggatgcggtccttaattgggtggagatatact
gagataaaatacaactacagggagaacatggatctgatagaagccacgattcttcctgac
gaagaggtggagaagacactgaaagacaaattcaatattactctagataagaaacttcaa
ccagtgaataaaggcaagtcatctgtgtttcaccacttggccagactctaa

DBGET integrated database retrieval system