KEGG   Alligator sinensis (Chinese alligator): 102378898Help
Entry
102378898         CDS       T02922                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00480  Glutathione metabolism
asn00590  Arachidonic acid metabolism
asn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102378898 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102378898 (GPX7)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102378898 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 102378898
NCBI-ProteinID: XP_006035230
UniProt: A0A1U7SNX4
Position
Unknown
AA seq 210 aa AA seqDB search
MLDPEGSVEHRLAPALPRAALLSLAMLLAAVALLLLALSASQQKEVDFYTFKAVNIRGKL
VSLEKYRGSVSLVVNVASECGYTDSHYKALQQLQRDLGPYHFNVLAFPCNQFGQQEPDSD
KEIENFARKTYGATFPLFSKTAVSGAGANAAFKYLIESTGEEPTWNFWKYLVNPKGKVVK
AWDSTVSVDEIKPYINELVRKIILKKKDEL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgctagatccggagggcagtgtggagcacaggcttgcccctgccttgcccagagctgcc
ctcctctccctagccatgctcctggccgcggtggccctgctgctcttggccctctccgcc
tctcagcagaaagaagtggatttttatacctttaaagcggtcaacatcaggggcaagcta
gtttccttggagaaatacagaggctcggtgtccctggtggtcaatgttgcgagtgaatgt
ggctatacagacagccactacaaagctcttcaacagctgcagagagacctcggcccgtat
catttcaacgtgctggcattcccatgtaatcagtttgggcagcaggaaccagacagcgac
aaagaaattgagaactttgcccgaaagacttatggagctaccttccctttgttcagcaaa
actgcggtcagtggtgctggtgccaacgctgccttcaaatatctaattgagtccacggga
gaggaaccaacctggaacttctggaagtacttggtgaatcctaaggggaaagtggtgaag
gcctgggactctactgtctccgttgatgagataaaaccgtacatcaatgagcttgtaagg
aaaatcatcctgaagaagaaagatgaactgtga

DBGET integrated database retrieval system