KEGG   Alligator sinensis (Chinese alligator): 102379089Help
Entry
102379089         CDS       T02922                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn03013  RNA transport
Brite
KEGG Orthology (KO) [BR:asn00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102379089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:asn03012]
    102379089
Translation factors [BR:asn03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102379089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N CLN3 PCI
Motif
Other DBs
NCBI-GeneID: 102379089
NCBI-ProteinID: XP_025050730
UniProt: A0A3Q0FX45
Position
Unknown
AA seq 1127 aa AA seqDB search
MLSAAHDVLRRHQGPPNGTQPGPLEPLSPNGSSHYDCNAMSTGAVLLADILPTLVIKVSA
PFYIHLLPYGLRVGICVLSAWGSFLLVAVAPSVALSLAGVVLASVSSGLGEITFLALTAF
YPSGPVSWWSSGTGAAGLLGAVSYLGLTQAGLSPPQTLLAMMGVPLVLLLSYWCLLLPPT
PETPSPTRQPLLEGGPPKPEPGPAALSLADKGRIMKVSCGQGGGVSMYQLLYQLGVFISR
SSLRCVRLRATWVLALLQRDPVAPRRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGRAY
SKAKSIVDKEGVPRFYVRLLADLEDYLNELWEDKEGKKRMNKNNAKALSTLRQKLRKYNR
DYEALIAAYKQNPEQSADEDEEKKSDDSEGSSSSSEDDDDEGISAAAFLKKKEVQGGDTR
AKFLKKMEDEDSDSESSDDDEDWVSSDSDSDSESDEDDGKFTSLASKFLKKDEDKRSSEK
KREEKAKKKHDRKARRDEDEDEDAEGGEWEKVKGGVPMSKPKMFAKGTEITHAVVVKKLN
EILQARGKKGTDRAGQIDLLQLLVAIAAENNLGVAMEVKIKFNIVASLYDYNPNLAPYMK
VWGXXXXPEMWQKCLASIDELLDILFANPNIFIGENILEESENLGNPEQPFRVRGCILTL
VERMDEEFTKIMQNTDPHSQEYVEHLKDEGRVCGIVARLQRYLQDKGSTEELCRVYLRRV
LHTYYKFDYKALQRQRGPAGDSKSEQDQAENEGEDSAVLMERLCKFIYARDRTDRIRTCA
ILCHIYHHALHSRWYAARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLIKD
AHNALLDIQSSGRAKELLGQGLLLRSLQERNSEQEKVEKRRQVPFHMHVNLELLECVYLV
SAMLLEIPYMAAHELDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGD
WRTCHRFIVNEKMNGKVWDLFPEADKVRDMLVRKIQEESLRTYLFTYSSVYDSISMEILA
DMFQLDLPTVHSIISKMIINEELMASLDQPTQTVAMHRTEPTAQQTLALQLAEKLGALVE
NNERVLDHKQGSYGGGYFRDQKDGYRKNEGGYMRRGGYRQQERSSNY
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgctcagcgccgcccacgacgtcctgcggcgccaccaggggccgcccaatggcacgcag
ccgggccctctggagccgctgtcccccaacgggtcatcgcactacgactgcaacgccatg
tcgacgggggccgtgctgctggctgacatcctgcccacgctggtcatcaaggtctcggcc
cccttctacatccacctgctgccctacggccttcgggtggggatctgcgtgctcagcgcc
tggggcagcttcctgctcgtcgctgtggcacccagcgtggccctcagcttggcaggcgtg
gtgctggccagcgtgtcgtcggggctgggggagatcaccttcctggcactcaccgccttc
taccccagcgggccggtgtcatggtggtcgtcgggcacgggggctgcggggctactgggg
gccgtctcctacctggggctgacacaggcggggctcagccccccgcagaccctactggcc
atgatgggggtgcccctcgtcttgctgctcagctattggtgcctgctgctgcctccgacc
cctgagaccccctcccccacccggcagcccctcctggaagggggaccccccaagccagag
cctgggccagcagcactgagcctggcagacaagggccgcatcatgaaggtgagctgtggc
cagggcgggggggtgtcaatgtaccaactgctctaccagctcggcgtcttcatatcgcgc
tcctcactgcgctgtgtccggcttcgagccacctgggtcctggccctgctgcagagggac
cccgtggccccgcgcaggttcgaggagctgaccaacctgatccgcaccatccgcaacgcc
atgaagatccgcgacgtcaccaagtgcctggaggagttcgagctgctgggccgcgcctac
tccaaggccaagagcatcgtggacaaggagggcgtcccccgcttctacgtgcgcctgctg
gccgacctggaggactacctcaacgagctgtgggaggacaaggagggcaagaagcgcatg
aacaagaacaacgccaaggccctgagcaccctgcgccagaagctgcgcaagtacaaccgt
gactacgaggcactcatcgccgcctacaagcagaaccccgagcagtcagccgacgaggac
gaggagaagaagagcgacgactcagagggctcgtccagctcgtcggaggacgacgatgac
gagggcatcagtgccgcggccttcctcaagaagaaggaggtgcaggggggcgacacccgt
gccaagttcctcaagaagatggaggacgaggattcggactcggagtcatcagacgatgac
gaggactgggtctcttccgactcagactcagattcggagtcagatgaggacgacggcaag
ttcacttcccttgcctccaagttccttaagaaagacgaggacaagaggagctcagagaag
aagcgggaggagaaggccaagaagaagcatgaccgcaaggcacggcgcgatgaagatgag
gatgaggacgccgaaggcggcgagtgggagaaggtcaagggcggcgtgcccatgagcaag
cccaagatgttcgccaagggcacagagatcacgcacgccgttgtggtcaagaagctcaac
gagatcctgcaggcacgcggcaagaagggcacagaccgggcagggcagattgacctgctg
cagctgctggtggccatcgcggctgagaacaacctgggggtggccatggaggtgaagatc
aagttcaatatcgtcgcctcgctctacgactacaaccctaacttggccccctacatgaag
gtatgggggtgnnnnnnnnnnccggagatgtggcagaagtgtctggcctccatagacgag
ctgctggatatcctcttcgccaaccccaacatctttataggcgagaacatcctggaggag
tcggagaacctcggcaacccagagcagcccttccgagtgcgcggctgcatcctgacgctg
gtggagcgcatggatgaggagttcaccaagatcatgcagaacacggacccccactcccag
gagtacgtggagcacctgaaggacgaggggcgagtgtgtggcatagtggcgcggctgcag
cgctacttgcaggacaagggcagcacggaggagctgtgccgcgtgtacctgcgccgtgtg
ctgcacacctattacaagttcgactacaaggccctgcagcgccagcgcggccccgctggt
gactccaagtcggagcaggaccaggcagagaacgagggtgaggacagcgcggtgctcatg
gagcggctctgcaagttcatctatgcccgcgaccgcaccgaccgcatccgcacctgcgcc
atcctctgccacatctaccaccatgctctgcacagccgctggtatgcggcccgtgacctc
atgctcatgtcgcatctgcaggacaacatccagcacgccgacccccccgtgcagatcctg
tacaaccgcaccatggtgcagctgggcatctgtgccttccgccagggtctgatcaaggat
gcgcacaacgcgctgctggacatccagtcgagcgggcgtgccaaggagctgctgggccag
gggctgctgctgcgcagcctgcaggagcgcaactcggagcaggagaaggtggagaagcgg
cgccaggtgcccttccacatgcacgtcaacctggagctgctggagtgcgtgtacctggtg
tcggccatgctgctagagatcccctacatggccgcccacgaactggatgcacggcgccgc
atgatcagcaagcagttccaccaccagctgcgcgtcggcgagcgccagcccctcctcggc
ccgcccgagtcaatgcgggagcacgtggtggcagcctccaaggccatgaagatgggcgac
tggcgcacctgccaccgcttcatcgtcaacgagaagatgaacggcaaggtgtgggacctc
ttccccgaggccgacaaagtccgtgacatgctggtccggaagatccaggaggagtctctg
cgcacctacctcttcacctacagcagtgtctatgattctatcagcatggagatcctggca
gacatgttccagctggacctgcccacggtgcacagcatcatcagcaagatgatcatcaac
gaggagctcatggcctcgctggaccagcccacgcagacggtggccatgcaccgcacggag
cccacggcgcagcagacgctggcgctgcagctggccgagaagctgggggcgctggtggag
aacaacgagcgggtgctggaccacaagcagggctcctacggcggcggctacttccgcgac
cagaaggacggctaccgcaagaacgagggcggctacatgcgccgcggcggctaccggcag
caggagcgcagctccaactactga

DBGET integrated database retrieval system