KEGG   Alligator sinensis (Chinese alligator): 102379615
Entry
102379615         CDS       T02922                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:asn01002]
    102379615 (ADAMTS13)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102379615 (ADAMTS13)
Peptidases and inhibitors [BR:asn01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102379615 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 TSP1_spondin ADAM_spacer1 Reprolysin_3 Reprolysin_5 TSP1_CCN Reprolysin_2 Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 102379615
NCBI-ProteinID: XP_006029843
UniProt: A0A1U7SFZ6
Position
Unknown
AA seq 1597 aa
MSTRFMILAFTMFPLGFGWLSPFQEKFLRALDPEDVFSYFGTKSVLDVPEFIVVQPACTC
EEDQVGLTACKVQRCSLQSWGKLYTFEFLEDPDLLPPSFVSHRVLNASVSLLKWFPDNCF
AGGKLLHPLGAVCRVSYCEGQLQGIIIASEEKIHIRPVRSKHWSLLKDLSFFRPHLIFRT
TGRGAKTAKEKKFHPRHWKRSEGTVKHLELLVVAGPDVYQFHREDTERYILTNLNIGAEL
LRDASLGAQFRVHLMRIIVLTEPEADMNITTNITSSLISVCEWSKKVNPPDDSDPQHADL
VLYVTRFDLELLNGNKELRGATQLGGACSSSWSCIITEDTGFDLGVTMAHEIGHSFGISH
DGEENSCSKSGFIMGTEGSHNSIDLAWSECSREQFLAFISTGQASCINDLPNLGGSIPGW
KPGLYYGVDEQCKVAFGAAATACTFADSNVDMCSVLSCHTTPAEQSSCTRLLVPLLDGTE
CGINKWCSKGRCSSLEELNPVTVVHGHWSSWNPFTSCSRSCGGGVAMRQRFCNNPRPAFG
GQQCLGEDLQAEMCNTQACGTTQVDFMAEQCAATNPQPFYITAGVASFYNWTSAASDAAE
DILCKYMCRAAGKNFIGSRGEGFTDGTRCRPSGSDAHGAFSLCVMGSCRVFGCNGKMDSG
KVMDACKVCGGDNTTCTRVSGSYVEGKAREYVTFLALPGNTTEVHVVNRKPLFTHLAVKI
KGQYVVAGKGTISLNTTYPSVLEDSQIRYTLFLTQDHLPILEEIHVDGPTQEDIEIQVYR
KYGKEYGDKTSPDITFSYFVPKENQAYAWIPWRGTCSVTCGEGDQLVDHVCFDQTRDEIT
DEQQCLETPRPPSRHEPCTMAPCPPSWAPGSFGQCSSSCGGGVMERLVRCVEKIGGLILT
LPDYKCIDSPKPASTELCNTQLCPLRWKGSEPGKCSAICGVGVAQQNLTCVQVHGDLETV
VNDSLCPVEEKPPSVVSCVVNICPLGWTTQEDTHSLAALVPAETIEKADRSVYVWSPLVG
DCSVTCGGGATQLHYVCVAFDTKEEAPEENCSSVPKPESRMEICNPSPCPPSWEVKELAP
CPVTCGGGRVPLSIRCIRQEGNTTHALLLSECIQIPWPTSSNECGTVPCPARWQYKTDSC
SASCGGGVTRRILYCAREAGEKVEEIVADAQCHGLPRPEELELCNLEPCPPRWKIVRTSP
CSSSCGMGVAVQVVICVQIHQGLESQLEESLCPEAEKPISRIPCVIRMCSYEWGFTDWTE
CSASCGNGIQMRQDFCLNPKTHEHVNPVFCLRSPKPITVRGCSAGPCPKPSAAAKSSGEP
QMSSSATNLLMMAVTVSPEKPKYKDLDLPPMGMPAPPLIGSEEDAAGMEDTAGESSICGR
LFLNTMGVINMTGLQVNDCTVTIGRPLGEVVTVKVLESSLNCSAGEIVLFSGRLMWRTGC
RKLTMASLSTRTNTLIVRQRLVFLGNGIVFQYNSKAATKKHYQDCDVQLFGSRGEIVNPV
ESPDPRRQVACRTFITVAPRHRIAIRALYMDLGPESNHTYSSYILIRDVNTMKTVVFHGK
QLFFWESTGSQAEIEFHDDFTEGHGSFRAEYQVTEPR
NT seq 4794 nt   +upstreamnt  +downstreamnt
atgagcacccgctttatgatcttagcttttactatgttccccttgggcttcggctggcta
tctcctttccaagagaaatttctcagggctttggatccagaagatgttttttcttatttt
ggcaccaagtcagttcttgatgtacctgagttcattgttgttcagcctgcttgcacctgt
gaagaagaccaggttggactgaccgcttgtaaagtccaacgctgttcccttcagtcatgg
ggaaagctctacacctttgaatttctagaggatcctgatctccttcccccttcctttgtg
agccatcgagtgctgaacgcttctgttagcttgctaaaatggttcccagacaactgcttt
gcagggggaaaactactgcatcctttgggggctgtgtgtagggtcagttactgcgaagga
cagctgcaaggcatcatcattgcaagtgaggaaaagattcacatcaggcctgtgagaagt
aaacactggagcctgctgaaggacctcagcttcttcaggccccacctcatcttcagaact
acagggagaggggcaaagacagcaaaagaaaaaaagtttcatcctcgccattggaaaagg
tctgaggggactgtcaagcacctggagctgctggttgtagcaggcccagatgtgtaccag
ttccacagagaagacactgagaggtatatcctcaccaacctgaacattggtgccgaactg
ctgagagatgcttcactgggagctcagttcagggttcacctcatgagaataatcgtcctg
acagaaccagaggcagatatgaacatcaccacgaatatcacctcctccctcatcagcgtg
tgtgagtggagcaagaaggtcaatcccccagatgactcggatccccagcatgctgatctt
gtgctgtatgtgaccagatttgacctggagttactgaatgggaacaaagagcttcgtgga
gccactcagctgggtggagcctgctcctcctcttggagctgcattatcactgaggacact
ggctttgacttgggggtcaccatggcccatgagattgggcacagttttggaatctcccat
gatggtgaggagaactcttgcagtaagagcggcttcatcatgggcactgagggcagccac
aacagcattgacctggcctggtcagagtgtagcagagagcaattccttgccttcatcagt
acaggccaagccagctgcataaatgacctgccgaacctgggaggcagcatccctgggtgg
aagcctggcttatactatggcgtggatgagcagtgtaaagttgcctttggggccgcagcc
acagcttgcaccttcgctgacagcaatgttgacatgtgcagcgtcctctcttgccacaca
accccagctgagcagtccagctgcactcgcttgcttgtcccccttctggatggtactgag
tgtggaatcaataagtggtgctccaagggccgatgtagctctctggaggaactgaaccct
gtcacagtggtacacggccactggtccagctggaaccccttcacttcctgctcccgcagt
tgcggtggtggagttgcaatgaggcaacgattctgtaacaaccctaggcctgcttttgga
ggccagcagtgcctgggagaggacctccaagcagagatgtgcaacacccaggcctgcggg
acaacccaggtagacttcatggctgagcagtgtgccgctaccaaccctcagccattttac
atcactgcaggcgttgcctctttttacaattggacttcggcagccagtgatgctgcagag
gacattctgtgcaagtacatgtgcagggcagctggcaagaacttcattgggagccgtggg
gagggcttcactgatgggactaggtgcaggccaagcggttccgacgctcacggcgcgttc
agtctctgtgtgatgggaagctgcagggtgtttgggtgtaatggtaagatggactccggg
aaggtgatggatgcttgcaaggtctgcggtggagacaacaccacatgcaccagagtgagc
ggttcctacgtggaaggaaaggcccgagaatatgttacatttctggccctgcctggcaac
accactgaggtccatgttgtcaatcggaaacccctcttcacgcatttggctgtgaagatc
aaaggtcagtatgtggtggctgggaagggaacaatctcattgaacactacctacccatca
gtactggaagacagccagatcagatacacgctgtttctcactcaggaccacctgccgatc
ctagaggaaatccatgtggatggaccaactcaagaggacatagagatccaggtttatcgg
aaatatgggaaagaatatggagataaaaccagtccagacatcaccttcagctactttgta
ccgaaggaaaaccaggcgtatgcatggattccatggcgtgggacctgctcagtgacctgt
ggggaaggggaccaattggtagatcacgtttgctttgatcagaccagggatgaaataaca
gatgagcaacagtgtctggagaccccacgacccccttccaggcatgagccatgtaccatg
gcaccgtgtcccccaagctgggcaccgggcagctttggtcaatgcagcagctcttgtggg
ggtggagtgatggagaggttggttcggtgcgtggagaagatagggggcttgatcctgact
cttcctgattacaagtgcattgattctcccaaacctgcttccacggagttgtgcaatacc
cagctgtgccccctaagatggaaaggatctgagccaggcaaatgctctgccatctgcgga
gttggggtggcccagcagaacctgacatgtgtccaggttcacggtgacttggaaacagta
gtaaatgacagcctctgcccagtggaagagaaaccaccctccgttgtgtcatgtgtggtt
aacatctgccctttaggctggaccacacaggaagacacccactccctggcggctttggtg
ccagctgagaccatcgagaaggcagatcgctctgtgtatgtctggagtcctctagttgga
gattgctccgttacctgtggtggaggtgcaacccagctccactatgtgtgtgtggctttt
gataccaaagaagaagccccagaagaaaattgtagctcagtgccaaagcctgagagtagg
atggaaatctgcaatcccagcccatgcccgccaagctgggaggtgaaggagctggctccc
tgccctgtgacctgtggaggagggagggttccactgtccattcgctgcatcagacaagaa
ggcaacacaacccatgctcttctcctctctgagtgcatccagataccttggcccaccagc
agcaacgagtgtggcactgtcccgtgtccagcgaggtggcagtacaaaacagactcgtgc
agtgccagctgtggtgggggcgtgacacgtcggatcctgtactgcgccagggaggctggg
gagaaggtggaagagattgtagcagatgcacagtgtcatggcctccctcgcccagaggag
ctggagctgtgtaacctggagccgtgccctccgaggtggaaaatagttaggaccagccca
tgttcctcctcctgcggtatgggcgtagccgtgcaggtggtcatctgtgtccagattcac
cagggcctggagagtcagctggaagagagcttatgtcctgaggcagagaaacccatctcc
aggatcccgtgtgtcatcaggatgtgttcgtatgaatggggcttcactgactggacggag
tgttcagcatcatgtggaaatggcattcagatgcggcaggatttctgcctcaacccaaag
acccacgaacatgtgaaccccgtcttctgcctgcgctcccccaagcccatcactgtgcgt
ggctgctcagctggcccctgtcctaagccatctgctgcggccaagtcctcaggggaaccc
cagatgtcatcttcagccacaaacctgctgatgatggcagtgactgtctctcctgaaaag
ccaaaatataaggacctggatcttcctccaatgggcatgccggcccctccgctgataggg
tctgaggaagatgcagcaggcatggaggacactgcaggagagtccagtatctgcgggagg
ctcttcctcaacaccatgggagtcatcaacatgaccggcctgcaggtcaatgactgcaca
gtcaccatcggccgtcccctgggggaagtggtaacagtcaaagtgctagagagctcctta
aactgcagtgcaggagagatcgtgctcttttctgggcggctgatgtggcggactggctgt
aggaagctgaccatggcgtctctcagcaccaggaccaacacactgatagtgagacagcgt
cttgtgttcctggggaacggcatagtttttcagtacaacagcaaagctgcaacaaaaaag
cattaccaagactgcgatgtgcagctgttcggctctcgaggagaaatcgtgaatcctgta
gagtctcctgaccccagaagacaagtggcctgtcgcaccttcatcaccgtggctccacgg
catcgcattgccattcgtgccctctacatggacctggggcctgagagcaaccacacatac
tccagttatatcttgatacgtgatgtaaacaccatgaagacagttgtgttccatgggaaa
cagctattcttttgggagtcaaccgggagccaggctgaaattgaatttcacgatgacttc
acagaaggccacggcagtttccgagcagagtaccaggtcaccgagcccagataa

DBGET integrated database retrieval system