KEGG   Alligator sinensis (Chinese alligator): 102381122Help
Entry
102381122         CDS       T02922                                 

Gene name
SPATA9
Definition
(RefSeq) spermatogenesis-associated protein 9
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00071  Fatty acid degradation
asn01212  Fatty acid metabolism
asn03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102381122 (SPATA9)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102381122 (SPATA9)
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102381122 (SPATA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf SPATA9
Motif
Other DBs
NCBI-GeneID: 102381122
NCBI-ProteinID: XP_006019774
UniProt: A0A1U7RGR5
Position
Unknown
AA seq 739 aa AA seqDB search
MHFQPSLPRLPVPRLEDSVRRYLAAQKPLLDDKQYRNTERIAKEFQKGIGKQLHQDLVDL
DKKNKYTSYISGPWFDMYLSAREPVVLNFNPFICLTPDPKEAYNKQLLRATNLVVSSIKF
LNSLRSNCLRPDIYYVNPKWSKSRPFKHFIRFLPSSVAWYGALLVNAYPLDMSQYKCLFN
SSRIPKLNKDELFTNECARHLLVMRNGHFYIFDVLDHLGNILHPSEIKAHLLYILQDADH
LPESSLCYLTTEDRNTWAKVRQQLIEVGNEENLMKIDSAVFCLCLDNSSPKDDDELSHCM
LHGNGFNRWFDKSFSLIVTSDGTAGINFEHSWGDGVAVLRFANEVHRNSTRHPAVVPQSA
LSAVKCERLEFKLNDSVKSAINTARMKFDKTKQKMFVRQFRFQKFGKEFIVKQKLSPDAV
FQLACQITAYRQYGKMVSCYEACSTAAFKHGRTETIRPTSVLSQQCSRAFVEERSKRAVA
ELRDLIDKCSKYHRRLQLEAALGKGFDRHLFALKHLAASKEILISRIAVDIIDDIKDELP
NIVKWKPLNQNDSTVQGSMSVVASVLSSSHAVRVISVLSRVSAASKSVAKFLQPQLVRKF
AQLDLLSGHLLQNPHTPLYTIQTTRCSLCDVICYPAKTVITSLMFAFYATLIYMALFINT
VLSKIKEIIQGKSSRENTKDSVDKKDLSLKYEDAARCTVPSPVKHVVSEFPVENSISSSI
HILHSALDQEKSTVVLHEN
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgcatttccagcccagcctgcccaggttgcctgttccaagattggaggattctgtcagg
agatacctggctgctcagaagcccctactggatgacaaacagtacagaaatacagaaaga
attgccaaggagtttcaaaaaggaataggcaagcagttacaccaagatcttgttgaccta
gataaaaagaataagtatacgagttatatatcaggtccttggtttgatatgtatctatct
gccagagaacctgttgttttaaacttcaacccttttatttgtttaactcctgatccaaaa
gaagcatacaacaaacagctactgagagctacaaatttggtagtatcatccataaaattt
ctcaactctctaaggagtaactgtttacggccggatatatattatgtcaaccccaaatgg
agcaagagtaggcccttcaaacacttcattcgctttcttccatcttctgtggcttggtat
ggagcacttctggtaaatgcatatccactagatatgtcacagtacaagtgtctcttcaac
agttccagaattcctaaattaaacaaagatgaactgtttacaaatgaatgtgcaagacat
ttgttggtaatgagaaatggtcacttttatatttttgatgttttggatcatcttggtaac
attctgcatccatctgaaattaaggctcatttgctttatattttgcaagatgcagatcac
ttgcctgaatcttccctttgttatttaaccaccgaagacagaaatacttgggcaaaagta
agacaacagcttatcgaagtgggtaatgaagaaaacttaatgaaaattgatagtgcagtc
ttttgcctatgtttagataatagttccccaaaggatgatgatgagctttcacattgcatg
cttcatggaaatggtttcaatcgctggtttgacaaatcttttagtttgattgtcacttct
gatggcactgcagggataaactttgaacattcttggggagatggagttgcagtccttcgt
tttgctaatgaagtacatagaaacagtacaaggcatccagctgttgtaccacagtctgca
ctaagtgctgtaaagtgtgagagactggagtttaaattgaatgattcagtaaaatctgct
ataaatacagcacgtatgaaatttgataaaacaaagcagaaaatgtttgtgagacagttc
agattccagaagtttggaaaagaatttatagtgaagcaaaagctgagtccagatgctgtt
tttcagcttgcatgtcagataactgcttatcgacagtatggaaaaatggtttcttgttat
gaagcatgtagcacggctgcttttaaacatggccgtacagaaacaattcgacctacatct
gtactgtcacaacagtgttctcgtgcgtttgttgaagaacggagcaaacgcgctgtggca
gaactgagagacttgattgacaaatgttcaaagtaccacagacggctacagctggaagct
gcattaggcaaaggatttgatcgccacttatttgcactgaaacatcttgcagcatccaaa
gagattttgatttcaagaatagctgtggacattatagatgacattaaggatgaacttcca
aacatagtaaaatggaaaccattaaaccagaatgattccactgtgcagggctcaatgtca
gttgtggcaagtgtactgtcctcatctcatgcagtaagagttatcagtgtgctaagcaga
gtctctgctgcttcaaaatccgtagccaaattcttgcagccacaactggtaagaaaattc
gcacagctggacttgctgtcagggcaccttctgcaaaatcctcacacaccactctataca
attcagactacaagatgctcactatgtgatgtgatctgctatccagcaaagactgttatc
accagtttaatgtttgctttctatgcaactctcatttatatggcactctttattaacaca
gtactaagtaaaataaaagagattattcaaggaaagtcctccagagaaaacacaaaggac
agtgttgataaaaaagatttatccctgaaatacgaagatgcagcaagatgtacagtaccc
tctccagtgaaacacgtcgtttctgaatttcctgttgaaaattcaataagcagcagtatt
cacatcctacattctgcactggaccaggaaaaatccactgtagttctacatgaaaattaa

DBGET integrated database retrieval system