KEGG   Alligator sinensis (Chinese alligator): 102381532Help
Entry
102381532         CDS       T02922                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00561  Glycerolipid metabolism
asn01100  Metabolic pathways
Module
asn_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102381532 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:asn01002]
    102381532 (MGLL)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102381532 (MGLL)
Peptidases [BR:asn01002]
 Serine Peptidases
  Family S33
   102381532 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 DLH Abhydrolase_2 Peptidase_S9 PGAP1 Thioesterase Abhydrolase_5 LIDHydrolase DUF1350 DUF1057 Abhydrolase_3 TMEM117 PAF-AH_p_II
Motif
Other DBs
NCBI-GeneID: 102381532
NCBI-ProteinID: XP_006017835
UniProt: A0A1U7RRT9
Position
Unknown
AA seq 309 aa AA seqDB search
MGRPSRMPEESSPRRSPQHVPYQDLPHMVNADGQYLFCRYWKPAATPRALVFIAHGAGEH
CGRYDDLAQMLTGLNLFVFAHDHVGHGQSEGERMVVSDFHIFIRDSLQHIELMKNEHPDL
PIFILGHSMGGAISILTASERPNDFSGMVLISPLVVASPEAATPIKVFAAKVLNFVLPNL
SLGSIDPNVVSRNKKEVESYTSDPLVHHGGMKVSFVIQLMNAIARIERALPKLTLPILVL
HGSPDKLCDIKGSYLLMDTVLSQDKTLKVYDEAYHALHKELPEVSTAVFKEILTWIGQKV
AAAEESSHT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtccttccagaatgccagaggaaagttcccccagaaggagtcctcagcatgtc
ccttatcaggaccttccccacatggtcaatgcagacgggcagtacctcttctgcagatac
tggaaaccggcagcaaccccaagggccctcgtgtttatcgctcatggcgctggggaacac
tgcggccgctatgatgacttggcccagatgctgacaggacttaacttgtttgtatttgca
catgaccatgttggccatgggcagagcgaaggggagcgtatggttgtgtctgatttccac
attttcatcagagacagcttgcagcacattgaactcatgaagaatgaacaccctgatctg
cccattttcattctggggcattccatgggtggagccatctctattctaactgcaagtgag
aggccaaatgacttttcgggcatggttttaatttctcctttggttgtagcaagccctgag
gcagcaacacccatcaaggtttttgcagcgaaagtgctcaactttgtcctaccaaacctg
tccctgggatccatagatccaaatgtggtttcccggaataagaaggaggttgaatcttac
acatctgatcccctggtccaccatggaggaatgaaagtctcctttgtcatccagctgatg
aatgccattgccagaatagaacgggccctccccaaattgaccctgccaatcttggtgctg
catggctcacccgacaagctctgtgacatcaaaggatcctatctgctgatggacacagtg
ctgagccaggacaaaacactcaaggtgtatgatgaggcctatcatgctctccacaaagag
ctgcccgaggtcagcactgctgtctttaaagaaatactgacgtggatcggtcagaaggtc
gcagctgccgaagaatccagccacacttaa

DBGET integrated database retrieval system