KEGG   Alligator sinensis (Chinese alligator): 102382581Help
Entry
102382581         CDS       T02922                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X2
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04012  ErbB signaling pathway
asn04020  Calcium signaling pathway
asn04114  Oocyte meiosis
asn04217  Necroptosis
asn04261  Adrenergic signaling in cardiomyocytes
asn04310  Wnt signaling pathway
asn04912  GnRH signaling pathway
asn04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102382581 (CAMK2D)
   04310 Wnt signaling pathway
    102382581 (CAMK2D)
   04020 Calcium signaling pathway
    102382581 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102382581 (CAMK2D)
   04217 Necroptosis
    102382581 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102382581 (CAMK2D)
   04916 Melanogenesis
    102382581 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102382581 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:asn01001]
    102382581 (CAMK2D)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102382581 (CAMK2D)
Protein kinases [BR:asn01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   102382581 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_4 SnoaL_2 DUF4915
Motif
Other DBs
NCBI-GeneID: 102382581
NCBI-ProteinID: XP_006031746
UniProt: A0A1U7S5S9
Position
Unknown
AA seq 529 aa AA seqDB search
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKITTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINNKTNVVTSPKENIPTPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTSFEPEALG
NLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKT
MQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKVPSTSVKILLTKPPGML
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaccactacctgcaccaggttcaccgacgagtaccagctcttcgaggagctc
gggaagggagctttctcagtggtgagaagatgcatgaaaattaccacaggacaagagtat
gctgccaaaattatcaacaccaaaaagctctctgctagggatcaccaaaagttggaaagg
gaagccagaatttgtcgccttttgaagcaccctaatattgtgcggcttcatgacagcata
tcggaagaaggattccattacttagtctttgacttagtcactggaggggaactgtttgaa
gacatagtcgcaagagaatattacagtgaagcagatgccagtcattgtatacagcagatt
ctagaaagtgttaatcattgtcatctaaatggcatagttcacagagacctgaagcctgag
aacttgcttttagctagcaaatccaagggagcagcagtaaaattggcagactttggattg
gctatagaagttcaaggagaacaacaagcttggtttggttttgctggtacaccaggctat
ctttcaccagaggtgttacgaaaagatccctatgggaaaccagtagatatgtgggcatgt
ggtgtcattctttatattctcctggtgggatatcctcctttctgggatgaagaccagcat
agactgtaccagcagatcaaagctggtgcatatgactttccctccccagagtgggataca
gtgactccagaagccaaagaccttatcaacaaaatgctcactatcaaccctgccaaacgt
atcacagcatcagaggcactgaagcatccttggatctgtcaacgttctactgttgcctca
atgatgcacagacaggagactgtagattgcttgaagaaattcaacgcaagaagaaaatta
aagggagccattttgacaaccatgctggctaccagaaatttttcagcagcaaagagctta
ctgaagaaacctgatggagtcaagataaacaacaaaaccaacgtagtaaccagccccaaa
gaaaatattcctaccccagcgctggagccccaaactacagtaatccacaaccctgatgga
aataaggaatccacagaaagttccaatacaaccatagaagatgaagatgtaaaagcacgc
aaacaggagattatcaaggttactgagcagttgattgaagccatcaacaatggggacttt
gaagcttacacaaagatctgtgatccaggacttacatcttttgaaccagaagctctgggt
aatctagtggaaggaatggactttcaccggttttactttgaaaatgctttgtctaagagt
aataagccaatccacactattatcctcaatcctcatgtccatctcgtgggtgatgatgct
gcctgtattgcatacatacggctgacacagtatatggatggaagtggaatgccaaagact
atgcaatcagaggagacccgggtctggcaccgtcgtgatggaaaatggcagaatgtgcat
tttcatcgttcagggtcaccaacagtacctatcaaggtcccttccactagtgtgaagata
ctattaacaaaacctcctggcatgctgtga

DBGET integrated database retrieval system