KEGG   Alligator sinensis (Chinese alligator): 102384330Help
Entry
102384330         CDS       T02922                                 

Gene name
CKB
Definition
(RefSeq) creatine kinase B
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00330  Arginine and proline metabolism
asn01100  Metabolic pathways
Module
asn_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102384330 (CKB)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102384330 (CKB)
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102384330 (CKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 102384330
NCBI-ProteinID: XP_014372591
UniProt: A0A1U8CX46
Position
Un
AA seq 381 aa AA seqDB search
MPFSNSHNLLKMKYPAEDEFPDLSVHNNHMAKVLTPELYSKLRGKQTPSGFTLDDIIQTG
VDNPGHPFIMTVGCVAGDEESYDVFKELFDPVIEDRHGGYKPSDEHKTDLNSDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLSVEALGSLDGDLKGKYYALKNMT
DAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGMWHNDNKTFLVWINEEDHLRVISM
QKGGNMKEVFTRFCSGLTQIETLFKTKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
NLGKHEKFGDILKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
VEMEKQLENGQSIDDLIPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctcgaacagccacaacctgctgaagatgaagtacccggccgaggacgagttc
ccggacctgagcgttcacaacaaccacatggccaaggtgctgaccccggagctgtactcc
aagctgaggggcaagcagacacccagcggcttcacgctggacgacatcatccagactggg
gttgacaacccaggccatcccttcatcatgacggtaggatgtgtagctggtgatgaagaa
tcctatgatgtgtttaaggaactctttgatccagttattgaagaccgacatggaggctac
aaaccaagtgatgagcacaagactgacttgaactctgataaccttcagggtggtgatgac
ctggatcctaactatgtgctaagttcccgtgtcagaactggtagaagtatccgtggattt
tgtcttccccctcactgtagcagaggagagagacgggcgatagaaaagctttctgttgaa
gccctgggaagtctggatggtgacctgaaagggaaatactatgctctgaagaatatgact
gatgcagagcagcagcagctgattgatgatcacttcctgtttgataagccagtttctcct
cttctgttggcatctgggatggcacgagactggccggatgccagagggatgtggcacaat
gacaacaagaccttccttgtctggatcaatgaggaagatcaccttagagttatttctatg
cagaaaggaggcaatatgaaagaagtattcacccgcttctgcagtgggctaacgcagatt
gaaacactgtttaaaacaaaaaattatgaattcatgtggaacccccacttgggctacatc
cttacctgcccatccaacctgggaacaggtctccgtgctggtgtccatatcaagctgcca
aaccttggcaagcatgagaagtttggagacattctcaagaggctgaggctgcagaaacga
ggcacaggtggtgttgatactgctgctgttggaggagtgtttgatgtttccaatgctgac
cgtctgggtttctcggaggtagagctggtgcagatggtggttgatggtgtgaagctgctt
gttgaaatggaaaaacaacttgaaaatggtcagtctattgatgacctcataccagctcag
aaataa

DBGET integrated database retrieval system