KEGG   Alligator sinensis (Chinese alligator): 102384380Help
Entry
102384380         CDS       T02922                                 

Gene name
FKBP7
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP7
  KO
K09573  FK506-binding protein 7 [EC:5.2.1.8]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:asn03110]
    102384380 (FKBP7)
Enzymes [BR:asn01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     102384380 (FKBP7)
Chaperones and folding catalysts [BR:asn03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    102384380 (FKBP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 102384380
NCBI-ProteinID: XP_025072335
UniProt: A0A3Q0HNZ7
Position
Unknown
AA seq 220 aa AA seqDB search
MALALAVALQALGLLATPALGQTPEPTAGREEVKIEVLHVPADCSPRSRRGDMLNAHYDG
YLARGGARFYCSRTQNEGHPKWFVLGVGQVIKGLDTGMMNMCPGEKRKVTIPPSLAYGEQ
GYAQAKIPPNATLIFDIELYAVHKGPRSVEAFQQIDIDNDKKLSQDEISQYLKQEFARDG
KKRDPSDHDIILTDIFKKNDHDGDGFISAKEYNVYQHDEL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggcgctggcagtggcgctgcaggcgctcgggctcctggcgacccccgcgctg
gggcagacgccggagccgaccgcggggcgggaggaggtcaagatcgaggtcctgcacgtc
cccgccgactgcagcccgcgcagcaggaggggcgacatgctcaacgcgcactacgacggg
tacctggcccgcggcggggcccgcttctactgcagtcggacacaaaatgaaggccatcca
aaatggtttgttcttggtgttggacaagtaataaaaggattagatactggtatgatgaat
atgtgtcctggagaaaaacggaaagtgacaattccaccatcattagcgtatggagagcaa
ggatatgcacaagccaagattccaccaaatgcaacgttgatctttgacattgaactgtat
gcagtacataaaggaccacggagtgttgaagcttttcaacagatagacatagataatgac
aaaaaactctctcaagatgagataagccaatatttaaaacaggaatttgccagagatggt
aaaaagcgtgatccttcagatcatgatattattttaactgatatattcaagaagaatgac
catgatggagatggcttcatatctgccaaggaatacaatgtctaccaacacgatgaacta
tag

DBGET integrated database retrieval system