KEGG   Alligator sinensis (Chinese alligator): 102384392Help
Entry
102384392         CDS       T02922                                 

Definition
(RefSeq) L-amino-acid oxidase-like
  KO
K03334  L-amino-acid oxidase [EC:1.4.3.2]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00250  Alanine, aspartate and glutamate metabolism
asn00270  Cysteine and methionine metabolism
asn00280  Valine, leucine and isoleucine degradation
asn00350  Tyrosine metabolism
asn00360  Phenylalanine metabolism
asn00380  Tryptophan metabolism
asn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asn01100  Metabolic pathways
Module
asn_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102384392
   00270 Cysteine and methionine metabolism
    102384392
   00280 Valine, leucine and isoleucine degradation
    102384392
   00350 Tyrosine metabolism
    102384392
   00360 Phenylalanine metabolism
    102384392
   00380 Tryptophan metabolism
    102384392
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    102384392
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.2  L-amino-acid oxidase
     102384392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Thi4 FAD_oxidored Pyr_redox_2 Pyr_redox FAD_binding_2 AlaDh_PNT_C DAO FAD_binding_3 HI0933_like Pyr_redox_3 MCRA IlvN FMO-like TrkA_N Trp_halogenase 2-Hacid_dh_C GIDA NAD_binding_9 3HCDH_N Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 102384392
NCBI-ProteinID: XP_006037063
UniProt: A0A1U7SJT2
Position
Unknown
AA seq 527 aa AA seqDB search
MKLLITCVINRTILSFVHLSLALFQLFVLVLALSAGGVSSYPEHCLHDPDYDHLVKIAKH
GLGKAAHPKKIVIVGAGISGLTAAKLLRDAGHKVIVLETSGSIGGRVKTYRDETQDWYVE
LGAMRLPRIHRIVREFIRQFHLKLNEFSQMNDNAWYLVNGIRARVRQVKQNPDMLNYTLH
RSERGKSASELYREILQAAILELQSSECKKYLDKYDSFSTKEYLIKKGNLSHGAVKMIGD
LLNEDSGYYLSFLSSLMDFDIFSHEEGFDEITGGFDQLPIAFYYSMPGIVQLNSTVEKII
TNGNMVRVLYRAPDTLTPYVLTADYVLITVSAKATRLINFMPLLSPQKAHALRSVHYSSS
TKIALACPDRFWERDGIHGGQSITDHPSRFIYYPNHNFSSGVGVILASYTWNDDADFFVP
LSDEKCIDVVLDDLAEVHGIPKDHIQYVCDKHVIKRWNLDKHSMGAFAFFTPYQFMDYSK
ALFQKEGRVYFAGEHTAWPHAWIDSSMKSAVRAARNIHWDSNLPPGQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgctgattacttgtgtcattaacagaactattctttcgtttgtgcatctatcc
ctagcacttttccagctgtttgtccttgtgctagctctaagtgcgggaggcgtttctagc
tatcctgaacactgccttcatgatcctgattatgatcatctggtgaagattgccaaacac
ggactgggaaaggcagcccatccaaagaagattgtcattgtgggggcaggaataagtgga
ctcactgctgccaaacttctcagggatgcgggtcataaggttatagtcttggaaaccagt
ggtagtataggaggacgggtcaagacctatcgcgatgagacacaagattggtatgtggag
ctgggagccatgcgtttaccaagaatccacaggattgtgcgtgaatttattagacaattt
cacctgaagctaaatgagttctctcagatgaatgacaatgcctggtatttggttaatggc
atcagggcgagagtaagacaagtcaagcaaaatcccgatatgctgaattatactctgcat
cgttcagagaggggcaaatctgctagtgaactttatagggaaattctgcaggcggccata
ttggagctccagagttcagaatgcaagaaatatttggataaatatgactctttttctacc
aaggagtatttgattaaaaaaggaaacttaagccatggggctgtgaagatgattggtgac
ttgctgaatgaggactctgggtattacctgtcatttctcagctctctcatggattttgat
atcttctctcatgaagagggctttgatgagatcacagggggctttgaccagttgcccatt
gccttctattactctatgcctggcattgttcagcttaactccacggttgagaagataata
acaaatggtaacatggttcgagtgctttaccgtgcaccagacacactgactccttatgta
ctgacggctgactatgtcctcattacagtttcagccaaagccacaagactcatcaatttt
atgccactgctttccccccaaaaggcacatgccttgcgctctgttcactactccagctcc
accaagattgccttggcctgccctgacaggttctgggaaagagatgggattcatggtggg
cagtcaatcacggatcatccctccaggttcatctactaccccaaccacaacttctccagt
ggtgtgggtgtgatcctggcttcctatacttggaacgatgatgctgacttcttcgttcct
ctcagtgatgagaagtgcattgatgtagtgctagacgaccttgcagaagtacacggcata
cccaaggaccacatccagtacgtctgtgataagcatgtgataaaaaggtggaacttggac
aaacattccatgggggcgttcgccttcttcaccccgtaccagtttatggactattccaag
gccctgtttcagaaagaagggagggtctattttgcaggagagcacacagcttggcctcat
gcctggattgattcttctatgaaatctgctgtgagagcagcaagaaacattcactgggat
agcaacctacctccagggcaatag

DBGET integrated database retrieval system