KEGG   Alligator sinensis (Chinese alligator): 102384532
Entry
102384532         CDS       T02922                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04080  Neuroactive ligand-receptor interaction
asn04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102384532 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102384532 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 102384532
NCBI-ProteinID: XP_006027606
UniProt: A0A1U7SBI1
Position
Unknown
AA seq 63 aa
MRRREETAGPLAEAPDGKDPEEGNIRNLVYPRGARNGAGHRQNGWRKYRRPRPRLSHKGP
MPF
NT seq 192 nt   +upstreamnt  +downstreamnt
atgagaaggagagaggaaacagcagggcccctggctgaggcaccagatggaaaggatcct
gaggaggggaacatccgtaacctggtgtaccccagaggggcacggaatggagcaggacac
cggcagaatggctggcgaaagtaccggcggccaagacctcgtctctcccacaagggcccc
atgcctttctaa

DBGET integrated database retrieval system