KEGG   Alligator sinensis (Chinese alligator): 102385724Help
Entry
102385724         CDS       T02922                                 

Gene name
RARS
Definition
(RefSeq) arginine--tRNA ligase, cytoplasmic isoform X1
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:asn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    102385724 (RARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:asn01007]
    102385724 (RARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:asn03016]
    102385724 (RARS)
   03029 Mitochondrial biogenesis [BR:asn03029]
    102385724 (RARS)
Enzymes [BR:asn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     102385724 (RARS)
Amino acid related enzymes [BR:asn01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   102385724 (RARS)
Transfer RNA biogenesis [BR:asn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    102385724 (RARS)
 Prokaryotic type
   Other AARSs
    102385724 (RARS)
Mitochondrial biogenesis [BR:asn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    102385724 (RARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e Cnn_1N tRNA-synt_1 tRNA-synt_1g
Motif
Other DBs
NCBI-GeneID: 102385724
NCBI-ProteinID: XP_006015766
UniProt: A0A1U7RCW3
Position
Unknown
AA seq 650 aa AA seqDB search
MWDKEKEIKLLTAEIDRLKNFGCLGVSPSLEALRDENTKLKYRLNFLRKSLLDERNKPIK
SMININGRLQKLFGEAIKAAYPDLENPPLAVTPSQQPKFGDYQCNSAMGITQMLQKTKEQ
KVNPREIADNIVKNIPDNDCIAKVEIAGPGFINVHLREDFVSKQLSNLLVNGVQPPAIEK
RKKVVVDFSSPNIAKEMHVGHLRSTIIGDSMCRLFEFVGYDVLRLNHLGDWGTQFGMLIA
HLQDKFPDYLTVSPPIGDLQAFYKESKRRFDTEEEFKKRAYQCVVLLQSKNPDFIKAWKL
ICDVSRKEFQKIYDSLHITLIERGESYYQDMMKDIVQEFEERGFVQVDDGRKIVFVPGCS
VPLTIMKSDGGFTYDTSDLAALKQRLLEEKADIVVYVVDSGQSVHLQTVFAAGQMIGWYD
PKVTRVVHAAFGVVLGEDKKKFKTRSGDTVRLIDLLDEGLKRSMDKLKDKERDKVLTAEE
LKAAQTSVAFGCIKYADLSHNRMNDYIFSFDKMLDDRGNTAAYLLYAFTRIRAIARLANI
DEEMLQKAAREAELILDHEKEWKLGKCILRFPEILQKILDDLLLHTLCDYLYELATTFTE
FYDNCYCVEKDRQTGKIVKVNMWRMLLCEATAAVMAKGFDILGIKPVQKM
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtgggacaaagaaaaagaaatcaagcttctgactgcagagattgatcgactgaagaac
tttgggtgcttgggagtgtccccaagcttggaggccttgcgagacgaaaacacaaagctt
aagtatcgtctgaattttcttagaaagagccttctggacgaaagaaacaagccaataaaa
agcatgattaacatcaacggccgccttcagaagctctttggagaggctatcaaggctgca
tacccagatttagaaaatccccctctagcagttacaccaagtcagcagcccaaatttggg
gattaccaatgtaacagtgcaatgggcataacacagatgctgcagaaaaccaaggaacag
aaagtgaacccaagagagattgctgataacatagtgaaaaacatccctgataatgattgc
attgcaaaggttgaaattgctggacctggttttattaatgtccacttgagagaggatttt
gtctccaaacagctgagcaatctactggtgaatggagttcaaccaccagccattgaaaaa
agaaaaaaggtggtggttgacttttcctcccctaacattgccaaggagatgcatgttggt
cacctgcggtcaaccattattggagacagcatgtgtcgcctgtttgagtttgtgggatat
gacgttctgaggttaaaccatttaggagactggggcacccagtttggaatgctcattgct
cacctccaagataaatttccagattacctgactgtttcaccaccaattggggaccttcaa
gctttttacaaggaatctaaaaggagatttgacacggaggaggaatttaaaaaacgtgcc
taccagtgtgtggtgctactacagagcaaaaacccagattttattaaagcctggaaactc
atctgtgatgtatctcggaaagagttccaaaaaatctacgacagcttgcacattacacta
atagaaagaggggaatcctactatcaagatatgatgaaagacattgtgcaagaatttgaa
gaaagaggatttgtgcaagtggatgatggacgaaagattgtgtttgtcccaggatgttct
gttcccctaacaatcatgaaatcagatggaggtttcacatatgacacatctgacttagct
gcacttaagcaaaggctgcttgaggaaaaggctgatattgttgtttatgtggtggacagt
ggccagtcagtgcacttacaaacagtgtttgcagcaggtcagatgattggctggtatgat
cctaaagtgaccagagtagtccatgctgcctttggagtggtgctgggagaagacaagaag
aagtttaagactcgttcgggggacacagtgcgactcattgacctgctggatgagggactg
aaacgatcgatggacaaactgaaggacaaggagcgggacaaggtcctaacagcagaagag
ctgaaggctgcccagacatctgtagcttttggctgcattaaatatgctgatctctcccac
aacaggatgaatgattacatcttctcctttgataaaatgttggatgacagaggcaataca
gctgcttacttactctacgccttcactcgaatcagggctatagcacgtctggccaatatt
gatgaagagatgttacagaaggcagctagagaagcagagctaatactggaccatgaaaag
gagtggaagctaggcaagtgcattctgaggttccctgagattctgcagaagatcttggat
gacctcttattacacacgctctgtgactacctctacgagctggccactaccttcacagag
ttctacgataattgttactgtgtggaaaaagacaggcagactggtaagatagtaaaggtg
aacatgtggagaatgttactctgtgaagccactgctgcagtcatggcaaaagggtttgac
atccttggaatcaaacctgttcagaagatgtaa

DBGET integrated database retrieval system