KEGG   Alligator sinensis (Chinese alligator): 102385802
Entry
102385802         CDS       T02922                                 

Gene name
RDH5
Definition
(RefSeq) LOW QUALITY PROTEIN: 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102385802 (RDH5)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102385802 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-GeneID: 102385802
NCBI-ProteinID: XP_006035261
UniProt: A0A1U7SNZ7
Position
Unknown
AA seq 312 aa
MWAYAVLCMLLWAVAWLLRDRRRLPGLMGRHVLVTGCDSGFGCRLAQRLGRXEALRAACS
PRLRTSLLDLTSSESIASTLAWVQDEVGNQGLFGLVNNAGVANPMGPTEWLQAEDLRHVV
AINALGPAELTLGLLPLLKQAQGRVVNISSVLGRLAAAGGGYCPSKYAVEAFSDSLRRDM
APFGVRVCIVEPGFFRTAATDLGSIEAALGRCWLQLDPETRRSYGDDFFRQYLQVQRRIM
AWLCDPDLAKVTGCLEHALTAQYPRTRYSPGWDAKLLWLPASYLPACVVDAVLAAVLPKP
AGSIRRAPATPQ
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtgggcctacgcagtactgtgcatgctgctgtgggcggtcgcctggctgctgcgggac
cggcggcgcctgcccggcctgatgggccggcacgtgctggtcacgggctgcgactcgggc
tttgggtgccggctggcgcagcggctggggcgcngtgaggccctgcgtgctgcctgctcc
ccccgcctgcgcaccagcctgctggacctcaccagctctgagagcatcgccagcacactg
gcctgggtgcaagacgaggtgggcaaccaaggcctcttcgggctggtgaacaatgcgggg
gtggccaaccccatgggccccaccgagtggctgcaggccgaggacctgcggcacgtggtg
gccatcaatgcactggggccagcggagctgacactggggctgctgcccctgctgaagcag
gcgcagggacgcgtggtcaacatctccagcgtccttgggcgcctggcagccgcagggggc
ggctactgcccctccaagtatgctgttgaggccttctccgacagcctcaggcgtgacatg
gccccatttggtgtgcgggtctgcatcgtggagcccggcttcttccgcacagcggccacc
gacctgggcagtatcgaggcggcactgggccggtgctggctgcagctggaccctgagaca
cgacgcagctatggggatgacttcttccgccagtacctgcaggtgcagcggcgcatcatg
gcgtggctgtgcgatcccgacctggccaaggtgaccggctgcctggagcacgcgctgacg
gcccagtacccacgcacccgctacagccccggctgggatgccaagctgctgtggctgcct
gcctcctacctgcccgcctgcgtggtggatgccgtgctggctgccgtgctgcctaagcca
gccgggagcatccgcagggcacctgccaccccccaataa

DBGET integrated database retrieval system