KEGG   Alligator sinensis (Chinese alligator): 102385885Help
Entry
102385885         CDS       T02922                                 

Gene name
LTB4R
Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102385885 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:asn04030]
    102385885 (LTB4R)
G protein-coupled receptors [BR:asn04030]
 Rhodopsin family
  Lipid
   Leukotriene
    102385885 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv Srg 7tm_4 Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 102385885
NCBI-ProteinID: XP_006037964
UniProt: A0A1U7SAX1
Position
Unknown
AA seq 355 aa AA seqDB search
MENDTLSTSVPLSEQTSPLSGRTIGLVVLSLAFILGFPGNAFVIWSAACLVRKHTVTSLL
ILHLAVADGATLLTAPFFLRLLSIGQWEFGLFICQMCYYICGVCMYASVYLIVLMSLDRC
LAVSKPFLSQNIRTKVVARSLVLVIWLLSFLLAIPVIFYRRLENYSGRFICKLSHDNQQH
LVFHKLFEILTGCILPFFIIICCYIVIGHRLKETRFRRKRRTSRLITVIVVAFAVFWLPY
HFVNILEVVGKLSGLKSVTQAGGKAQPTLIALAFFSSSINPILYTFTGSSLLKAAGVGFM
AKLFDGTSSEIPSLRQGTGRSTQQREEVEMKVVRNENDENIAPTGLSVETTLDGC
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgacaccctctctacctcagtgcctctttcagaacagacatccccactgtct
ggcagaacgatagggctggtagtgctgtccctggcatttatccttggcttcccaggaaat
gcctttgtaatatggagtgcagcctgccttgtccggaagcacactgtcaccagcctcctg
atactgcacttggccgtggctgatggggccacactgctcactgcaccctttttcctccgg
ctgctgagcatcgggcaatgggagtttggtcttttcatctgccagatgtgctactatatc
tgtggggtgtgcatgtatgccagcgtctacctcattgtcctcatgagtcttgaccgctgc
ctggctgtttccaagcctttcctctcccagaacatccgcaccaaggtagtagccaggtcc
ttggtcctagttatatggctgttgtctttcctccttgccatccccgtcatcttctaccgc
cgattggaaaattactctggccgcttcatctgcaagctatctcatgataatcagcaacat
ttagttttccacaaactctttgagatcctgaccggctgcatactgccctttttcattatc
atctgctgttacatcgtcatcgggcaccggctgaaggagacgcgtttccggaggaagcgc
cgcaccagccggctcatcacagtcattgtggtggccttcgctgtcttctggctgccctat
cactttgtgaacatccttgaggtggtcggaaaactgagtggcttaaaaagtgtcacgcag
gctggagggaaggcacagcctaccctgattgctctggctttcttcagcagcagcatcaac
cccatcctctataccttcacgggtagcagcttgctcaaggcagcaggtgtgggcttcatg
gccaagctgtttgatggcacaagctctgagatacccagcttacggcaaggtactggtcgg
tccacccagcagcgtgaggaggtggagatgaaggtggtgaggaatgagaatgatgagaac
atcgccccaacaggattgtcagtggagaccacgttggatgggtgctga

DBGET integrated database retrieval system