KEGG   Alligator sinensis (Chinese alligator): 102388244
Entry
102388244         CDS       T02922                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X5
  KO
K04462  ecotropic virus integration site 1 protein
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102388244 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asn03000]
    102388244 (MECOM)
Transcription factors [BR:asn03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    102388244 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 102388244
NCBI-ProteinID: XP_006018791
UniProt: A0A1U7RIP6
Position
Unknown
AA seq 1053 aa
MKSEDYSHDTMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVEEDFQK
KLDNENDLRDMHEIQECKECDQVFPDLQSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGF
SFSFPGLFPSGLYHRPPLIPASSPVKGLPSTDQTNKSQSPLMTNPQILPATQDILKALNK
QPSVGENKPVELQPERSSEERPHEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIES
DKEKFKENGKMFKDKVSSLQNLASINNKKEHNNHSIFSPSLEEQTAVSGAVNDSIKAIAS
IAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKMEPQSP
SEIKKIPKGSSESPFDLTTKRKEEKPVTPVATKPAAPPVTSQDQPLDLSMGSRSRASGTK
QAEPRKNHVFGEKKGGELESRKTSESSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKY
LRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELIQSVPSMFNFRAPPS
ALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRH
VRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDK
EDSYFTEIRNFIGNSNHSNQSPRNSEERMNGSHFKDEKAMGASQNSDLLDDEEAEDEVMM
DEEDEESDIAAKVGKEPASSTIHEGTPEDDYEETSTLDMNCKTSPGRYKDDEYNKTGLSA
LDHIRHFTDSLKMRKMEENQYNETELAAFNTPHLPEDLKQPLYRKSKSQAYAMMLSLSDK
DSIHSASHNSPNVWHSMARAAAEASAIQSISHV
NT seq 3162 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattattcacatgacacaatggctcctgatattcatgaggagcgtcag
tatcgttgtgaggattgtgatcagctgtttgagtccaaggcagaactagtagaccatcag
aaattcccatgcagcacacctcactcagcgttttctatggtggaagaggactttcagaaa
aagcttgacaatgagaatgacctccgggacatgcatgaaatccaagaatgtaaagagtgt
gatcaagtgtttccagacttacaaagcctggagaaacacatgctgtcgcacagtgaggag
agggaatacaagtgtgaccaatgccccaaggcatttaactggaagtcaaacttgatacgt
catcagatgtcacatgacagtggaaagcactatgagtgtgaaaactgtgccaagcaggtt
ttcacggaccccagcaaccttcagaggcatattcgttcgcagcacgtgggggctcgtgct
cacgcttgtcccgaatgtggcaaaacgtttgctacttcttcaggcctcaaacagcataaa
cacatccacagcagtgtcaaaccctttatatgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgt
gaaggaaagaaccattttgcagcaggaggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgaatcatgcaaatccgggccttgct
gactattttggagccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttcaggcttgtaccacaggccacctttgatacct
gctagttctcctgttaaaggactaccaagcacagaccagacaaacaaaagtcaaagtccc
ctcatgacaaatcctcagatactgccagctacacaggatattttgaaggcactaaataaa
caaccatctgtaggtgaaaataagccagtggagcttcaaccagagaggtcctctgaagag
aggccgcacgaaaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacc
cccagtggcagtgacttggagaccacctcgggctctgatctggagagtgacattgaaagt
gataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagctctcttcag
aatttggcttcaataaataataagaaagaacacaacaatcattccattttctcaccatct
ttagaggagcaaactgcggtttcaggagctgtgaatgattctataaaggctattgcttct
attgctgagaaatactttggttcaacaggacttgtggggctgcaagacaaaaaagttgga
gctttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatg
tatccatttcctgatagagacttgagaccattacctttgaaaatggaaccccaatcacca
agtgaaataaagaagatcccaaagggaagctctgagtctccctttgatctcaccactaaa
cgtaaggaggagaagcccgttactcctgtagcaaccaagccagcagctccacctgtgaca
agccaggaccagcctctagacctaagcatgggtagcagaagtcgagccagtggtacaaaa
caggctgaacctcggaaaaaccatgtgtttggtgaaaagaaaggaggtgaacttgaatca
aggaaaacatctgagtcctctttacaacatgccaggcccactccattctttatggatcct
atttacagagtagagaaaagaaagttaactgatccacttgaagctttaaaagaaaagtac
ttgagaccttcccctggattcttgtttcatccacaattccaattgcctgatcaaagaact
tggatgtcagctatcgaaaacatggccgaaaagctagagagttttagtgccctgaaacca
gaagccagtgaactcatacaatctgtcccgtccatgttcaacttcagagcccctccaagt
gccctcccagaaaaccttctcagaaagggcaaggaacgctatacctgcagatactgtggt
aagattttcccaagatctgcaaacctaacacgtcacctgaggacgcacactggagaacag
ccctacagatgcaaatactgtgacaggtcctttagcatatcttctaacctgcagaggcac
gtccgtaacatccacaataaggagaagccattcaaatgtcacttatgtgacaggtgtttt
ggtcaacaaaccaatctagacagacatctaaaaaagcatgagaatgggaacatgtctggt
actgcaacatcctcacctcactcagaactcgaaagcacaggggcaattctagacgacaaa
gaggattcttacttcacagaaattcggaatttcattgggaacagcaaccacagtaaccaa
tcccctagaaattcagaagagagaatgaatggcagccacttcaaggatgagaaagccatg
ggggcgagtcagaactccgacttgttggatgatgaagaggcagaagatgaagtaatgatg
gatgaagaggatgaagaaagtgatattgcagcgaaggtgggcaaagaacctgcttcaagt
accatacatgaaggaacccctgaggatgactatgaggaaacaagtactttggatatgaat
tgcaagacttcccctggcaggtataaagacgatgagtataataagactggactatcagct
ttggaccacataaggcacttcacagatagcctcaaaatgaggaaaatggaagaaaaccag
tacaatgaaactgaactggcagcctttaatactccccacctgccagaggacctaaagcaa
ccactgtacaggaaatcgaagtcccaggcatacgctatgatgctctctctctctgacaag
gactccatccattctgcatcccataattctcccaacgtgtggcacagtatggcaagagct
gccgcagaagccagcgccatccaatccattagtcacgtatga

DBGET integrated database retrieval system