KEGG   Alligator sinensis (Chinese alligator): 112550261Help
Entry
112550261         CDS       T02922                                 

Definition
(RefSeq) dedicator of cytokinesis protein 6-like isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:asn04131]
    112550261
Membrane trafficking [BR:asn04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    112550261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3398 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 112550261
NCBI-ProteinID: XP_025059659
UniProt: A0A3Q0GJ08
Position
Unknown
AA seq 570 aa AA seqDB search
MVASEVRKQMSREHGSSPQLSERRSGSHQTVPLAEVVEPLDVEEFLAAHPPEAESGHLRD
LADFPPDDLEVIQEPRELRTLEPGVPEEGMLDMRTQDAVKTYTEDWLVVRRRYQGLSTAY
TPITPQRQRERQQGLPRQVFETDEPEVEDVEERRRSSGSLDETPRGSWASSIFDLRNSVP
DAPLPGLLERTAPEEADLRNAALRREGRHPEILALFPAPDEDEAVERRSPPEMPREHFGQ
RILVKCLSLKFEIEFEPIFGSLALYDIKEKKKISENFYFDLNSEAVKGLLQGHSAPPAIS
SLARAAIFSISHPSPDIFLVIRLEKVLQQGDIGECCEPYMVLREADGAKNKEKLERLRTA
AEQFCSRLGRYRMPFAWTAVHLRNVLSSASAPERDPPDPDTGRKGTWKRRTLDRLSVGDE
ACGFGNFRPATLTITNFFKQEGDRLSDEDLYKFLADMRRPSSLLRRLRPITALLKIDISP
APESPHYCLSPELLHVRPYPDPRVRPTKEILEFPAREVFAPYTMYRNLLFIYPQSLNFSS
RQGSMRNIAIKVQLMAGEDPSQALPVPAVL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctccgaggtacggaagcagatgtcgcgggagcatgggagctccccccagctc
tcagagcgtcgcagtggctcccaccagaccgtgccgctggcagaggtggtggagccactg
gatgtggaggagttcctggccgcccacccccctgaagctgagtcagggcacctgcgcgac
ctggctgactttccacctgatgacctcgaggtcatacaggagccacgggagctccgcaca
ttggagccaggggtccctgaggaggggatgctggacatgcgaacacaggatgcagtgaag
acctacactgaggactggctggttgtacgccggaggtaccagggcttgagcacggcttac
actcccatcaccccgcagcggcagcgagagcggcagcagggcctgccccggcaggtcttt
gagacagatgagccagaggtggaggatgtggaggagcggcggcgcagctcaggctcgttg
gatgagacgccacgtggcagctgggcgtctagtatcttcgacctgaggaactcagtgcct
gatgcaccgctgcccggcctgctggagcgcacagcccccgaggaggctgacctgcgcaat
gctgccctgcgcagggagggccgccaccctgagatcttggctctctttcctgcccctgat
gaggatgaggcagtggagcgccgcagccccccagaaatgccccgggagcacttcgggcag
cgcatcctggtcaagtgtctgtcccttaaatttgagattgaattcgagcccatcttcggg
tctcttgccctttatgacatcaaggagaagaagaagatttcagagaacttctactttgac
ctgaactcagaagcggtgaaggggctactgcagggccacagtgcccccccagctatctct
agcctggcccgtgctgccatcttctccatcagccacccctcccctgatatcttccttgtc
atcaggctggagaaggtgctgcaacagggggacatcggggagtgctgcgagccctacatg
gtgctgcgggaggcagatggtgccaagaacaaggagaagctggagcggctgcggacggcg
gcagagcagttctgcagccgcctgggccggtaccgcatgccctttgcatggacagctgta
cacctgcgcaatgtcctcagcagcgccagtgctcccgagcgtgaccccccggaccctgat
actggtcgtaaaggcacctggaagcggcggacactggatcgcctgagcgtgggggatgag
gcctgtggttttggcaacttccgcccggctacactcaccatcaccaacttcttcaagcag
gagggtgaccgcctaagcgatgaggacctgtacaagtttttggctgacatgcggcgccca
tcatctctgctgcggcggctccgtcccatcacagctctgctgaagattgacatctctccg
gcacccgagagcccccactactgcctgtcaccggaactgctgcatgtgcggccctaccct
gacccccgcgtgcggcccaccaaggagatcctggagttccctgcccgtgaggtctttgcc
ccctacaccatgtacaggaacttgctcttcatctacccccagagcctgaacttcagctcg
cgccagggctccatgcgcaacattgccatcaaggtgcagctcatggctggtgaggacccc
agccaggccctgccagtgcccgcagttctatga

DBGET integrated database retrieval system